KEGG   Calothrix sp. PCC 7507: Cal7507_6141Help
Entry
Cal7507_6141      CDS       T02358                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cal7507_6141
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cal7507_6141
   00680 Methane metabolism
    Cal7507_6141
Enzymes [BR:calo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cal7507_6141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6990142..6993225)
Genome map
AA seq 1027 aa AA seqDB search
MSSLLYSLSQAANIYPTSELFLRHRLQIVEELWESVLRQECGQKMVDLLRQLRDLCSPEG
QATDDQASSAVKLIEQLNINEAIRAARAFALYFQLINIIEQEYEQRQQLTRYSELEAAAA
EPESLPNISYSSNKGEDDAPVNGALAADMLAKNWISKQKEKQKGTFSALFPHLFKLNVPP
QQIQRLIAQLDVRLVFTAHPTEIVRHTIRDKQRQVVTLLQHLDTAENRTGNTIGGYPWEA
AELREKLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYQRFKYSLNKT
FPWLEPPQKNFCSFGSWVGSDRDGNPSVTPETTWQTACYQRKMVLERYVQSVKKLIELLS
VSMHWSDVLPDLLESLELDQSQLSEVYDALALRYRQEPYRLKLSYVLRRLENTRDRNLAL
YKRETPKNEGTPMYRSGADFLTELRLIHRNLTETGLSCRELENLISQVEIFGFDLTQLDI
RQESSRHADALNEILEYLQVLPQPYNELSEAQRVAWLTGELQTRRPLIPAELPFSEKTND
VIQTFRIVRSLQQEFGVNICQTYIISMCREVSDVLEVLLLAKEARLFDPAIAVGTIQVVP
LFETVEDLQRSRSVMRQLFELPLYRALLAGGYEVIKARKENIPPSSPLPISPAFSPLTPD
LQEIMLGYSDSNKDSGFLSSNWEIHKAQKSLQQTAEDYDLNVRIFHGRGGSVGRGGGPAY
EAILAQPGHSINGRIKITEQGEVLASKYSLLDLALYNLETITTAVIQASLLRTGFDDIQP
WNEIMEELAARSRTHYRALIYDQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLTS
LRAIPWVFSWTQTRFLLPSWYGVGTALQEFLNEEPEEHLKLLSYFYIKWPFFKMVISKAE
MTLAKVDMQMARHYVQELSNPEDLPRFEKVFEQIASEFYLTRDLVLKITGHNRLLDGDPV
LQRSVQLRNGTIVPLGFIQVSLLKRLRQSRNTTSTSGVIHSRYSKGELLRGALLTINGIA
AGMRNTG
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgagttccctgttatactctttatctcaggctgctaatatctatcccacctccgaatta
tttttacggcatcggctgcaaatagtggaggagttgtgggagtcggttctgcggcaagaa
tgcggtcaaaagatggtagatctgttgcggcaactacgcgatctatgttcgccagaagga
caagccactgatgaccaagcttcctcggctgtcaagttgattgaacaactcaacatcaat
gaagcaattcgggcagctcgtgcttttgctttatattttcagctgattaatatcatagag
caggaatatgaacaacggcagcaattgactcgttattctgaattggaggcagcagcagca
gagccggaaagtctacccaatatcagttattcatcgaataaaggcgaagacgacgcaccc
gttaacggcgcactagcagcagatatgctggcgaagaattggattagcaaacagaaagaa
aagcagaaaggtactttttcggctttgttcccccatttatttaagttgaacgtaccaccc
cagcaaattcaacgcctgatagcgcagttggatgtgcgtttggtgtttacagcccacccc
acagaaattgtccgtcacaccatccgcgataagcagcgccaggtagtcacactcttgcag
catctggatacggcagaaaaccgcaccggtaacacaatcggaggttatccttgggaagcg
gcagaactcagagaaaaattactggaagaaatccgtctgtggtggcgcacggatgaactc
catcagtttaaaccgacggtgttggatgaagtagactacgctttgcactacttccaagaa
gttctatttgatgggattccccaactttatcaacgcttcaaatattctctgaataaaacc
tttccttggctagaaccgccacagaaaaatttctgctcttttggttcttgggtaggttca
gacagagatgggaatccatcagtgacaccagaaacaacttggcagacggcttgctatcag
cgcaaaatggttctggaaagatatgttcagtcagtgaaaaagctgattgagttattgagt
gtatcaatgcactggagtgatgtactaccagacttgttagaatccctggagttggatcag
tcccaattgagtgaagtatatgatgcattggcgctgcgttatcgccaagaaccctaccgt
ctgaaattgtcttatgtactcagaaggttggaaaatacacgcgatcgcaatttagctttg
tataagcgagaaactcccaaaaatgaaggcactcccatgtatcgttcgggagccgatttt
ctcacggaactgcggttaatccatcgcaatttgaccgaaacaggtttaagctgtcgggaa
ctagaaaatctcattagccaggtagaaatttttggctttgatctgacacagttggatatt
cgccaagaatcatcccgccacgccgatgcactcaatgagattctggaatacctgcaagta
ttaccccaaccttataacgaattatcggaagcacagcgagtagcttggctgacaggagaa
ctgcaaacccgtcgtcccttaattccggcggaattgccattctcggaaaaaaccaacgat
gtgattcaaaccttccgcatcgtgcgatcgctacaacaagagtttggtgtcaacatctgc
cagacttatataattagcatgtgccgcgaagtcagcgacgtgctagaagtattgctgtta
gccaaagaagcgagactttttgatccggcgatcgcagttgggacaattcaagttgtaccc
ttgtttgaaacggtagaagacttacaacgctccagaagcgtcatgcgtcaactgtttgag
ctaccgttatatcgtgctttattagctggtggctacgaagtcattaaggcccgtaaagaa
aacatccccccctcttcccctctccctatctcccccgccttttcacccctcacccctgac
ttgcaagaaatcatgttggggtattctgacagcaacaaagactctggttttttaagcagc
aactgggaaattcataaagcgcaaaaatccctccaacaaaccgcagaggattacgatctc
aacgtgcgaattttccacgggcgcggtggttctgtgggacgtggtggggggccggcttac
gaggctattttggctcaaccaggtcacagtattaatggacggatcaaaatcacagaacaa
ggggaagttttagcttccaaatactccttgctggatttagctttatacaatctggaaact
atcaccactgcagtcattcaagctagcttgctgcggacagggtttgacgatattcaaccc
tggaatgagattatggaggagttagcagcgcgatcgcggactcattatcgcgctttaatt
tatgaccagccagattttatcgactttttccaccaagtcactcccatagaagaaattagc
cagctgcaaattagctctcgtccagcgcgtcgtccatcaggtaaaaaagatttaaccagt
ctcagagctattccttgggtatttagctggacacaaacccggtttttgctgccttcttgg
tacggtgttggcacagctttgcaagagttcttaaatgaagaaccagaagaacatctgaag
ttactcagctacttttacatcaagtggcccttcttcaaaatggtgatttccaaagcagaa
atgaccttagccaaagtagacatgcaaatggcacgtcactacgtccaagaactatccaac
cctgaagatttacctaggtttgaaaaggtttttgagcaaatcgccagtgaattctatctc
actagagatttagtgttaaaaatcactggccataatcgactgttagatggtgatcctgtc
ttacagcgttcagtccagttacgcaatggcacaattgtccctttaggattcatccaagtt
tccttactcaaacgcctccgccaatcccgcaacactacttccacctctggggttatccac
tcccgttacagcaaaggcgagttattgcgaggcgcattgttaaccattaacgggattgct
gcagggatgagaaatactggttga

DBGET integrated database retrieval system