KEGG   Calothrix sp. PCC 6303: Cal6303_1248Help
Entry
Cal6303_1248      CDS       T02372                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cal6303_1248
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cal6303_1248
   00680 Methane metabolism
    Cal6303_1248
Enzymes [BR:calt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cal6303_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1448741..1451794)
Genome map
AA seq 1017 aa AA seqDB search
MGSLIYSFAEAVNIYPASDLFLRHRLQVVEELWEEVLQQECGQATVDLLKKLRDLCSPEG
QATKDQAASVFKLIEQLSINEAIRAARAFALYFQLINIIEQDYEQRQQLTRYEAEPENKG
EEAVTSTVYCQDEESFHHNNGVGAEMLAKSWHNSDNSKHKGTFSGLFPQLFKLNVPPQQI
QRLISHLDVQLVFTAHPTEIVRHTIRGKQRQVVQLLQQLDALEKRAGGSLTGGFLWEAEE
LQSQLIEEIRLWWRTDELHQFKPSVLDEVDYALHYFQEVLFDAIPQLYRRFKHTLNQTFP
WLEPPQKNFCKFGSWVGGDRDGNPSVTPAITWETACYQRNIVLEKYTKAVKQLIELISVS
MQWSDVLPDLLESLEMEQAQMSEVYDQLALRYRQEPYRLKLSYILKRLENTSIRNKALQK
GEILNDEHHHHVYHSGEEFLAELRLIQHNLSETGLTSQQLENLICQVEIFGFNLTQLDIR
QESSRHADALNEVVEYLGILNKPYNDMSEVERVAWLTSELKTRRPLIAAELPFSEKTNDV
ISTFRIVRSLQQEFGYNVCQTYIISMCREVSDVLEVLLFAKEAGLYDPGTAIGTIQVVPL
FETVEDLLRSRSVMGELFELPLYRALLAGGYEITENHPNSLSPTSSPLTPNLQEVMLGYS
DSNKDSGFLSSNWEIHKAQKSLQEIAEGYGISLRIFHGRGGSVGRGGGPAYEAILAQPGH
SINGRIKITEQGEVLASKYSLRDLALYNLETITTAVIQASLLKTGFDDIEAWNEIMEELA
ARSRQHYRALIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLTSLRAIPWVFS
WTQIRVLLPSWYGVGTALQEFLNEEPEEHMKLLRYFYIKWPFFKMVISKAEMTLAKVDLQ
MASHYVQELSHPEDKPRFDKVFAQIAEEYYLTRNLVLQITGNKCLLDGDPVLQRSVQLRN
GTIVPLGFIQVSLLKRLRQSKNIPTSAVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcttatatactcttttgctgaagcagtaaatatctatcctgcatccgattta
tttttacgccatcgccttcaggtggtagaagaactgtgggaagaagtattacaacaagaa
tgtggtcaagcaacggttgatttactcaaaaaactgcgggatttatgttcaccagaggga
caagcgactaaagatcaggcagcttcggtgttcaaattaatcgaacaattgagcatcaat
gaagcaatcagggcagcacgagcatttgcactgtattttcagctgatcaatattatcgag
caagattacgaacaacgccaacaattaactcgctacgaagctgaaccagaaaataaaggc
gaagaagcagttacaagcaccgtatactgccaagatgaagaaagctttcaccataataat
ggtgtcggagcagaaatgctggctaaaagttggcataattccgacaatagtaaacataaa
gggactttttccggattattcccccaactattcaaattgaatgttccaccccaacaaatt
caacgtttaatttcccatttggatgtacagttagtttttacagcacacccaacagaaatt
gtccgccataccattcgtgggaaacaacgtcaagttgtccagcttttacagcaattggat
gccttagaaaaacgggcaggtggaagtctcacaggcggctttttgtgggaagctgaagaa
ctccaatcacaattaatcgaagagattagattatggtggcgaactgatgaattacaccag
tttaaaccctccgtcctagatgaagtcgattatgctctccactacttccaagaagttctc
tttgatgccataccccaactatatcgccgcttcaaacataccctgaaccaaacctttccc
tggttagaaccacctcaaaaaaacttctgtaaatttggttcctgggtaggaggagacaga
gatggaaatccatcggtgacaccagcaattacttgggaaactgcatgttaccaaagaaat
atagtcctagagaaatataccaaagctgtaaaacaactaattgagttaattagtgtctcc
atgcagtggagtgatgtgcttcccgatttgctggaatccctggaaatggaacaagcgcag
atgagcgaagtttacgatcaattggcactacgctaccgccaagagccatatcgattgaag
ctatcatacatcctcaagcggttggaaaataccagcatccggaacaaagctttacaaaaa
ggcgaaattctcaacgacgaacatcatcatcacgtttaccattccggagaagaattcctc
gcggaactgcggctaattcaacacaacctttcggaaacaggtttaactagccaacagcta
gaaaacctcatttgtcaagtggaaattttcggctttaacctgacacagctagatattcgt
caagaatcatctcgtcatgccgatgcgttaaacgaagttgtcgagtatttagggatttta
aacaaaccctacaacgacatgagcgaagttgagcgggtagcttggttaaccagcgaactt
aaaacccgtcgtcccctaattgccgcagaactaccattttccgagaaaaccaacgacgta
atcagcactttccgcatcgtgcgatcgcttcaacaagaatttggctataatgtctgccaa
acctacatcatcagcatgtgtcgtgaagtcagcgacgtgttggaagtcctactttttgcc
aaagaagccggactttatgatcctggtaccgcaatcgggacaattcaagtagttccccta
tttgaaaccgttgaagacttactgcgatcgcgtagtgtcatgggtgaactatttgaactt
ccactttaccgcgctctcctggcaggtggctacgaaatcaccgaaaatcatcccaactcc
ctctcccccacatcctcacccctcacccccaacctccaagaggtgatgctaggatattcc
gacagcaacaaagattctggctttttaagcagtaattgggaaatccataaagctcaaaaa
tccctccaggaaattgctgagggatacggtataagtttacgcatttttcatggtagaggt
ggttcagtagggcgaggtggtggaccagcctacgaagcaattttggcacaaccaggacac
agtataaatggacgcattaaaatcaccgaacaaggagaagtcctcgcctccaaatactcc
ctgcgcgacctagccctatataacctcgaaaccatcaccacagccgtcatccaagccagc
ctcctaaaaacaggcttcgacgacatcgaagcctggaacgaaatcatggaagaactcgcc
gcgcgatcgcgtcaacactaccgcgccctaatttacgaacaacccgacttcatcgacttc
ttccaccaagtcacccccatcgaagaaatcagccaactgcaaatcagttcccgtccagcc
cgtcgtccttccggcaaaaaagacctaaccagcctgcgggcaattccctgggtatttagt
tggacacaaatccgtgtccttctcccctcctggtatggagtcggcaccgccctccaagaa
ttcctcaacgaagaacccgaagaacacatgaagctgctgcgttacttctacatcaaatgg
cccttcttcaaaatggtaatttccaaagccgaaatgaccctggctaaagtagacttacaa
atggcaagtcattacgtccaggaattatcacatcccgaagacaaaccccgatttgataaa
gtcttcgcccaaattgccgaagaatactatctcacccgaaatttagttctgcaaattacc
gggaataaatgtcttttagatggcgaccctgtacttcagcgctcagtacaattacgcaac
gggacaattgttcccctaggatttattcaggtgtccctactcaaacgtttgcgccaatcc
aaaaatatccccacctcagccgtaattcattcccgctacagtaaaggggaactactacgt
ggtgccttgctgactatcaacggtatcgccgctggaatgagaaacacaggttga

DBGET integrated database retrieval system