KEGG   Calothrix sp. PCC 6303: Cal6303_1248Help
Entry
Cal6303_1248      CDS       T02372                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00620  Pyruvate metabolism
calt00680  Methane metabolism
calt00710  Carbon fixation in photosynthetic organisms
calt01100  Metabolic pathways
calt01120  Microbial metabolism in diverse environments
calt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cal6303_1248
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cal6303_1248
   00680 Methane metabolism
    Cal6303_1248
Enzymes [BR:calt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cal6303_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFZ00309
UniProt: K9UXX5
LinkDB All DBs
Position
complement(1448741..1451794)
Genome map
AA seq 1017 aa AA seqDB search
MGSLIYSFAEAVNIYPASDLFLRHRLQVVEELWEEVLQQECGQATVDLLKKLRDLCSPEG
QATKDQAASVFKLIEQLSINEAIRAARAFALYFQLINIIEQDYEQRQQLTRYEAEPENKG
EEAVTSTVYCQDEESFHHNNGVGAEMLAKSWHNSDNSKHKGTFSGLFPQLFKLNVPPQQI
QRLISHLDVQLVFTAHPTEIVRHTIRGKQRQVVQLLQQLDALEKRAGGSLTGGFLWEAEE
LQSQLIEEIRLWWRTDELHQFKPSVLDEVDYALHYFQEVLFDAIPQLYRRFKHTLNQTFP
WLEPPQKNFCKFGSWVGGDRDGNPSVTPAITWETACYQRNIVLEKYTKAVKQLIELISVS
MQWSDVLPDLLESLEMEQAQMSEVYDQLALRYRQEPYRLKLSYILKRLENTSIRNKALQK
GEILNDEHHHHVYHSGEEFLAELRLIQHNLSETGLTSQQLENLICQVEIFGFNLTQLDIR
QESSRHADALNEVVEYLGILNKPYNDMSEVERVAWLTSELKTRRPLIAAELPFSEKTNDV
ISTFRIVRSLQQEFGYNVCQTYIISMCREVSDVLEVLLFAKEAGLYDPGTAIGTIQVVPL
FETVEDLLRSRSVMGELFELPLYRALLAGGYEITENHPNSLSPTSSPLTPNLQEVMLGYS
DSNKDSGFLSSNWEIHKAQKSLQEIAEGYGISLRIFHGRGGSVGRGGGPAYEAILAQPGH
SINGRIKITEQGEVLASKYSLRDLALYNLETITTAVIQASLLKTGFDDIEAWNEIMEELA
ARSRQHYRALIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLTSLRAIPWVFS
WTQIRVLLPSWYGVGTALQEFLNEEPEEHMKLLRYFYIKWPFFKMVISKAEMTLAKVDLQ
MASHYVQELSHPEDKPRFDKVFAQIAEEYYLTRNLVLQITGNKCLLDGDPVLQRSVQLRN
GTIVPLGFIQVSLLKRLRQSKNIPTSAVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcttatatactcttttgctgaagcagtaaatatctatcctgcatccgattta
tttttacgccatcgccttcaggtggtagaagaactgtgggaagaagtattacaacaagaa
tgtggtcaagcaacggttgatttactcaaaaaactgcgggatttatgttcaccagaggga
caagcgactaaagatcaggcagcttcggtgttcaaattaatcgaacaattgagcatcaat
gaagcaatcagggcagcacgagcatttgcactgtattttcagctgatcaatattatcgag
caagattacgaacaacgccaacaattaactcgctacgaagctgaaccagaaaataaaggc
gaagaagcagttacaagcaccgtatactgccaagatgaagaaagctttcaccataataat
ggtgtcggagcagaaatgctggctaaaagttggcataattccgacaatagtaaacataaa
gggactttttccggattattcccccaactattcaaattgaatgttccaccccaacaaatt
caacgtttaatttcccatttggatgtacagttagtttttacagcacacccaacagaaatt
gtccgccataccattcgtgggaaacaacgtcaagttgtccagcttttacagcaattggat
gccttagaaaaacgggcaggtggaagtctcacaggcggctttttgtgggaagctgaagaa
ctccaatcacaattaatcgaagagattagattatggtggcgaactgatgaattacaccag
tttaaaccctccgtcctagatgaagtcgattatgctctccactacttccaagaagttctc
tttgatgccataccccaactatatcgccgcttcaaacataccctgaaccaaacctttccc
tggttagaaccacctcaaaaaaacttctgtaaatttggttcctgggtaggaggagacaga
gatggaaatccatcggtgacaccagcaattacttgggaaactgcatgttaccaaagaaat
atagtcctagagaaatataccaaagctgtaaaacaactaattgagttaattagtgtctcc
atgcagtggagtgatgtgcttcccgatttgctggaatccctggaaatggaacaagcgcag
atgagcgaagtttacgatcaattggcactacgctaccgccaagagccatatcgattgaag
ctatcatacatcctcaagcggttggaaaataccagcatccggaacaaagctttacaaaaa
ggcgaaattctcaacgacgaacatcatcatcacgtttaccattccggagaagaattcctc
gcggaactgcggctaattcaacacaacctttcggaaacaggtttaactagccaacagcta
gaaaacctcatttgtcaagtggaaattttcggctttaacctgacacagctagatattcgt
caagaatcatctcgtcatgccgatgcgttaaacgaagttgtcgagtatttagggatttta
aacaaaccctacaacgacatgagcgaagttgagcgggtagcttggttaaccagcgaactt
aaaacccgtcgtcccctaattgccgcagaactaccattttccgagaaaaccaacgacgta
atcagcactttccgcatcgtgcgatcgcttcaacaagaatttggctataatgtctgccaa
acctacatcatcagcatgtgtcgtgaagtcagcgacgtgttggaagtcctactttttgcc
aaagaagccggactttatgatcctggtaccgcaatcgggacaattcaagtagttccccta
tttgaaaccgttgaagacttactgcgatcgcgtagtgtcatgggtgaactatttgaactt
ccactttaccgcgctctcctggcaggtggctacgaaatcaccgaaaatcatcccaactcc
ctctcccccacatcctcacccctcacccccaacctccaagaggtgatgctaggatattcc
gacagcaacaaagattctggctttttaagcagtaattgggaaatccataaagctcaaaaa
tccctccaggaaattgctgagggatacggtataagtttacgcatttttcatggtagaggt
ggttcagtagggcgaggtggtggaccagcctacgaagcaattttggcacaaccaggacac
agtataaatggacgcattaaaatcaccgaacaaggagaagtcctcgcctccaaatactcc
ctgcgcgacctagccctatataacctcgaaaccatcaccacagccgtcatccaagccagc
ctcctaaaaacaggcttcgacgacatcgaagcctggaacgaaatcatggaagaactcgcc
gcgcgatcgcgtcaacactaccgcgccctaatttacgaacaacccgacttcatcgacttc
ttccaccaagtcacccccatcgaagaaatcagccaactgcaaatcagttcccgtccagcc
cgtcgtccttccggcaaaaaagacctaaccagcctgcgggcaattccctgggtatttagt
tggacacaaatccgtgtccttctcccctcctggtatggagtcggcaccgccctccaagaa
ttcctcaacgaagaacccgaagaacacatgaagctgctgcgttacttctacatcaaatgg
cccttcttcaaaatggtaatttccaaagccgaaatgaccctggctaaagtagacttacaa
atggcaagtcattacgtccaggaattatcacatcccgaagacaaaccccgatttgataaa
gtcttcgcccaaattgccgaagaatactatctcacccgaaatttagttctgcaaattacc
gggaataaatgtcttttagatggcgaccctgtacttcagcgctcagtacaattacgcaac
gggacaattgttcccctaggatttattcaggtgtccctactcaaacgtttgcgccaatcc
aaaaatatccccacctcagccgtaattcattcccgctacagtaaaggggaactactacgt
ggtgccttgctgactatcaacggtatcgccgctggaatgagaaacacaggttga

DBGET integrated database retrieval system