KEGG   Calothrix sp. PCC 6303: Cal6303_3045Help
Entry
Cal6303_3045      CDS       T02372                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cal6303_3045
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cal6303_3045
Enzymes [BR:calt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cal6303_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3605242..3606672)
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQAKSGYQAGVKDYRLTYYTPDYTPKDTDILAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVAGEDNQYIAYIAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVAEAIKKAQAETGEIKGHY
LNVTAPTCEEMMKRAEFAKELEMPIVMHDYLTAGFTANTTLAHWCRDNGILLHIHRAMHA
VIDRQKNHGIHFRVLAKTLRMSGGDHIHTGTVVGKLEGEKGITMGFVDLLRENYVEQDKS
RGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLAREGNDVIREACKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaactaagactcaagccaaatcagggtatcaggctggggtaaaagat
tacagattaacttattacactccagattacacacctaaagatacagatattttagctgca
ttccggatgactcctcagcctggagtgccacccgaagaagctggtgcggctgttgcggct
gagtcttctactggtacttggacaactgtatggacagacttgctgactgacttggatcgt
tacaaaggtcgttgctacgacatcgaaccagttgctggtgaagataaccaatacattgct
tatattgcttatcccctcgatttgttcgaggaaggttctgtaaccaacatgttgacctcg
attgtaggtaacgtgtttggtttcaaagctttgcgtgcattgcgtttggaagacttgcgg
attcctgtagcatacttgaagaccttccaaggtcctccacatggtatccaagtagagcgc
gacaaattaaacaaatatggtcgtcctttgttgggttgtacaatcaaaccaaaattaggt
ttgtctgctaaaaactacggacgcgctgtatatgagtgtctgcgcggtggtttggacttc
accaaagatgacgaaaacatcaattcacaacccttccaacgttggcgcgatcgcttcttg
tttgtagcagaagcaatcaagaaagcacaggcagaaaccggcgaaatcaaaggtcactac
ctcaacgttaccgctcctacctgcgaagaaatgatgaaacgggctgagttcgctaaagaa
cttgaaatgcctatcgttatgcatgactacctcaccgcaggtttcaccgctaacaccacc
ttggctcactggtgccgcgacaatggtatcttgctacacatccaccgtgccatgcacgcg
gtaatcgaccgtcaaaagaaccacggtatccacttccgtgtattagctaaaaccctccgc
atgtctggtggagaccacatccacaccggaaccgttgtgggtaaactcgaaggtgaaaaa
ggtatcaccatgggctttgtggacttactacgtgaaaactacgtagaacaagacaagtcg
cgcggtatctactttacccaagactgggcttccatgcccggagtaatggcagttgcttcc
ggtggtatccacgtatggcacatgcccgcattggttgaaatcttcggcgacgactccgta
cttcagttcggtggtggtaccttaggacacccatggggtaatgcacctggtgcaaccgca
aaccgtgttgctttggaagcttgtatccaagcacgtaacgaaggtcgtaacttggctcgt
gaaggtaacgacgtaatccgtgaagcttgtaaatggtctccagaattggctgttgcttgc
gaactgtggaaagaaatcaagttcgagttcgaggcaatggatacagtctga

DBGET integrated database retrieval system