KEGG   Cyclobacterium amurskyense: CA2015_2429Help
Entry
CA2015_2429       CDS       T03993                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
camu  Cyclobacterium amurskyense
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:camu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2015_2429
  Amino acid metabolism
   00310 Lysine degradation
    CA2015_2429
   00380 Tryptophan metabolism
    CA2015_2429
Enzymes [BR:camu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CA2015_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2929916..2932708)
Genome map
AA seq 930 aa AA seqDB search
MDKYSYISNAHVAYIDELYEDYKKDPEAIDSSWKAFFDGFDFAINKFGEEETRETASGNQ
APLNGNLATKGTIMNMEQLPKEIKVRAMIHAYRSRGHLRSKTNPVRERRDRRALLDLSDF
GLEKSDLDTVFQAGNEIGIGDAKLSKIIDSLKIIYEGSMGFEYMYIRDPEMLDWFRIIVE
KESLEFNPPLEEKKRILFKLNEAVVFENFLHTKYIGQKRFSLEGGESTIPFLDALINKAS
DLGVEEMMIGMAHRGRLNVLANVMGKTYEQIFSEFEGTATPDLTMGDGDVKYHMGFSSEV
PTTNGKLMILKLAPNPSHLEAVNPVVEGFVRAKIDDHYKGDEDKVIPILIHGDSAVAGQG
IVYEVTQMANLKGYNTGGTIHFVINNQVGFTTDFDDARSSIYSTDVAKIIDAPVIHVNGD
DPEAVVFAAKIAVEFRQKFNQDIFIDMVCYRRHGHNESDEPKFTQPELYNIISKHPNPRE
IYNKTLLDRGQVDAKLAKQMDKEFRQLLQDRLAMVKVKPLPYTISPFEKAWKALDYSKPE
DFEKSPNTSISKEAIEKVAEALTILPKGFKPIKQIEAQLKQRKEMFFQSKTLNWAAAELL
AYGSLLLDGKTVRMTGQDCERGTFSHRHAVVHDANTNKPYDSLKELKDSKGKFYIYNSLL
SEYAVLGFEYGYSMANPNALNIWEAQFGDFANGAQTMIDQFITSGESKWQKMNGLVMLLP
HGYEGQGPEHSNARPERFLQLAAEYNIIVANITEPSNFFHLLRRQLAWNFRKPCIVMSPK
SLLRHPKVISPLSEFTSGNFREILLDETTTPKKVNRVVLCSGKIYYELIEMREKEKIEDV
AIIRVEQLHPLPKNQILEALKAYKKDVETVWLQEEPENMGYWAFIVRNLYKDLAMDVIAR
KPSASPATGYHKVHLIEQKQILEKALKINP
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggataaatactcttatatttccaatgcccatgttgcttacatagatgagctatatgag
gattataaaaaagaccccgaagcaatagacagcagttggaaagctttttttgatggattc
gatttcgccataaacaaatttggtgaagaagaaacccgagagactgcttcaggtaatcaa
gctcctttaaatggcaacttggccacaaagggcactattatgaacatggagcaattacca
aaggaaataaaggtaagggcaatgatccatgcttacagatccaggggtcaccttaggtct
aaaaccaatcctgtaagagaaagaagagatcgacgtgctttgttggacttgagtgatttt
ggtttggaaaaatcagacttagataccgtctttcaagcaggaaatgagattggaataggc
gatgccaaactttccaaaataattgattccctcaaaatcatatatgaaggctcaatgggc
tttgagtacatgtacataagggatcctgaaatgctggattggtttaggataatcgtagaa
aaagaatctctggaattcaaccctcctttagaggagaaaaagagaatcctattcaaatta
aatgaagcagtagtttttgaaaacttcctgcataccaaatatataggtcaaaaaaggttt
tcattagaaggtggcgagagcaccattccattccttgatgcattgataaataaagcatca
gatttaggagtggaggaaatgatgataggaatggcccacaggggacgtctgaatgttctg
gccaatgtaatgggcaagacctacgaacagattttctctgaatttgaaggtactgctacg
ccagacttaaccatgggagatggtgatgtaaaataccacatgggcttctcttcggaagta
cctaccaccaatggtaaattaatgattttaaaattggctcctaatccttctcacttagag
gctgtcaacccagttgtagaaggatttgtgagggctaaaatagacgaccattataaagga
gatgaggacaaggtaattccaattcttatccatggggattcggctgtagcaggacaaggt
atcgtctatgaagtcacccagatggccaatctgaaaggctataacacaggtggaaccatc
cattttgtaattaacaatcaggtaggttttactacagattttgatgatgcaagaagctct
atctacagcacagatgtggccaagataattgatgcacctgttattcacgtcaatggtgat
gatcctgaagcggtggtatttgcagcgaaaattgctgttgaattccgtcaaaaattcaat
caggacatatttattgacatggtttgctatagaagacatggacacaatgagtctgacgag
cccaaatttacccagccggaattgtacaatatcatctcgaaacatcctaatccaagagag
atttacaataaaaccctattggacaggggccaggtagatgccaagcttgccaagcaaatg
gacaaagaattccgtcaattgcttcaagacagattggctatggtaaaggtaaaaccactt
ccctacaccatttcaccatttgaaaaggcatggaaagcattggattattccaaaccagaa
gattttgaaaaatctccgaatacatccataagcaaggaagccattgaaaaagtggcagaa
gcattgaccattcttcctaaaggatttaaaccaatcaaacaaatagaagcacagctcaag
caaaggaaagagatgtttttccaaagcaaaacactcaactgggctgcggcagaacttttg
gcatatggttctttattgcttgatggcaagaccgtcagaatgactggtcaggattgtgag
cgaggcaccttttcacataggcatgctgtagttcatgatgcaaataccaacaaaccttat
gactccttaaaggaattaaaggacagtaaaggtaagttctatatctataactccttattg
tcagagtatgcagtactgggctttgaatatggatattccatggccaacccaaatgcgctt
aacatatgggaagcccaatttggtgatttcgccaatggtgcacaaaccatgatcgaccaa
ttcatcacttcaggtgaatcgaaatggcagaaaatgaatggtttggtaatgcttttacct
catggatatgaaggacaaggaccagaacattccaatgcaagacctgaaaggtttttacaa
ttggctgcagaatacaatatcatcgttgccaatattacagaaccttcaaatttcttccac
cttcttcgccgtcaactggcttggaatttcaggaagccatgcatagtgatgtctccaaaa
tcattgcttcgtcatccaaaagtaatttcaccattaagtgaatttaccagtggtaatttc
agagagattttattggacgaaaccaccacccctaaaaaagtaaacagggtggtactttgc
tcaggaaaaatctactatgaattgattgaaatgagggagaaggagaaaattgaagatgta
gccattattcgtgtggaacaacttcatccgctgccaaaaaatcaaattctcgaagcatta
aaggcttacaaaaaagatgtagaaacagtttggcttcaggaagagccggaaaatatggga
tactgggccttcattgtcagaaatctttataaagatttggccatggatgtcatcgctaga
aagccaagtgcttcgccggcaacaggataccataaagtgcatctgatagaacaaaaacaa
attttggaaaaagctttgaaaataaatccttaa

DBGET integrated database retrieval system