KEGG   Cyanobacterium aponinum: Cyan10605_2593Help
Entry
Cyan10605_2593    CDS       T02376                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
can  Cyanobacterium aponinum
Pathway
can00620  Pyruvate metabolism
can00680  Methane metabolism
can00710  Carbon fixation in photosynthetic organisms
can01100  Metabolic pathways
can01120  Microbial metabolism in diverse environments
can01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan10605_2593
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan10605_2593
   00680 Methane metabolism
    Cyan10605_2593
Enzymes [BR:can01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyan10605_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DnaGprimase_HBD
Motif
Other DBs
NCBI-ProteinID: AFZ54668
UniProt: K9Z8H5
LinkDB All DBs
Position
complement(3085513..3088542)
Genome map
AA seq 1009 aa AA seqDB search
MTSVTTNYQEDLSIYSSSELLLRHRLKLVENLWESVLANECGQELIDLLERLKSACSPEG
QTTETENFSVSKWIEELELDDAIKAARAFALYFQLINIVEQHYEQRTQKLIRRTTTEAQV
NAIQKPSVNNKTSSIDGDSYFHPKLNPSSGGTFHWLFPHLKTLNVPPQKIQKLLDELDIS
LVFTAHPTEIVRHTIRKKQRRISYILEHLDRAEESYRAMGLTNSWEAENYRQCLLDEIRI
WWRTDELHQFKPTVLDEVDYALHYFQEVLFNTIPELFVRLKQALNNTFPKLQPPTHKFCY
FGSWVGGDRDGNPFVTPEVTWSTACYQRNLVLEKYIDSVNQLGDILSLSLHWSNVLPELL
DSLERDRIFMPEVYDKYYVRYRQEPYRLKLAYIEQKLENTKARNEALSNPETRKSIKLAH
KDDNVYPTTADFLTDLNLIKANLEHTGLNCKELEHLICQVEIFGFHLTPLDFRQDSSRHS
EALNEIAEYLGVLDKPYNELSEDEKTAWLTQELKTRRPLIPSEVTFSDNTKETIETFKVL
RGLQLEFGLDICHTYIISMTNYVSDVLEVLLLAKEAGLYDPILGVTTIRIVPLFETVEDL
KRAPEVMTELFELPLYRACLAGGYDNVDKSSSFLNLPELEPKNLQEIMLGYSDSNKDSGF
MSSNWEIHKAQKNLARIGDKYGLNIKIFHGRGGSVGRGGGPAYAAILAQPTSTINGRIKI
TEQGEVLASKYSLPELALYNLETISTAVIQASLLGSGFDDIEPWNEIMEEISVASRKAYR
QLIYEQPDFLDFFLSVTPIEEISKLQISSRPARRSSGKKDISSLRAIPWVFSWTQSRFLL
PAWYGVGTALQQFLDQEPEENLKLLRYFYLKWPFFKMVISKVEMTLSKVDLQMASHYIEE
LAKPEDKERFLKVFNQIAKEYYLSREMVLKINEQGRLLDNDPDLQRSVQLRNGTIVPLGF
LQVSLLKRLRQYANQNKAGLIHFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagtgactactaattatcaagaagatttgagtatatattcgagttcagaatta
ttactacgccaccgactgaaattagttgaaaatttatgggaatcagtattagctaatgaa
tgtggacaagagttgatagatttgttagaaagattaaagtcggcttgttctccagaaggt
caaaccaccgaaactgaaaatttttctgtgagtaaatggattgaggaattagaattagat
gatgccattaaagccgcccgtgcttttgctttatattttcagttaattaatattgttgaa
cagcactacgaacaaagaacacaaaaacttattcgtcgcactaccactgaggctcaggtt
aacgctatccaaaaaccgtcagtaaataataagacttcttctatagatggggatagttat
tttcatcctaagctcaatcctagcagtggtggaacttttcactggctttttccccattta
aaaactttgaatgtgccaccccagaaaattcaaaagttattggatgagttagatattagt
ttagtttttactgcacaccctacagaaattgtgcgtcatactattcgtaaaaaacaaaga
cgtatttcttatattttagagcatctggacagagcagaagaatcttatcgagccatggga
ttaactaactcttgggaggcagaaaattatcgtcaatgtctgttagatgaaattcgcatt
tggtggcgtacagatgaattacatcagtttaaacccactgtgttagatgaagttgattac
gctttacactacttccaagaagttttatttaataccattccagagctattcgttcgatta
aaacaggctttgaataacactttccctaaattacaacctcctactcacaaattctgctat
tttggttcatgggtggggggcgatcgcgatggaaacccttttgtaaccccagaggtaaca
tggtcaaccgcttgttatcagagaaatttggtgttagagaagtatattgactctgtgaat
cagttgggggatattctcagtttgtctctccattggagtaatgttttacctgagttgtta
gactccctagagcgcgatcgcatctttatgccagaagtttatgataaatattatgttcgt
tatcgtcaagagccttatcgcttgaaattagcctatattgagcaaaaattggaaaataca
aaagcaagaaatgaagccttatccaatcccgaaacaagaaagtcgattaaactagctcat
aaagatgataatgtttatcccactaccgccgattttttaacagatttaaacctaattaaa
gctaatctcgaacatactggcttaaattgcaaagaattagagcatttaatttgtcaggta
gaaatttttggtttccatctaactcccttagattttcgtcaagattcttcccgtcactca
gaagcattaaatgaaatagccgaatatttaggagttttagataaaccctacaatgaatta
tcagaagacgaaaaaaccgcatggttaacccaagaattaaaaacccgtcgccccttaatc
cccagtgaagtcactttttctgataataccaaagagacgatcgaaacttttaaagttcta
agaggattacaattagaatttggcttagatatatgtcatacctatattattagcatgact
aactatgtcagtgatgtattagaagtattattactagcaaaagaagcaggattatatgat
ccaattttgggagtaacaactattcgcatcgtgcctctatttgaaaccgtagaagactta
aaacgagcaccagaagtaatgacagaattatttgaattacccctttatcgtgcttgttta
gcgggtggttatgacaatgtggacaaatcatcttctttcctcaatctaccggaattagag
ccaaaaaatctccaagaaataatgctaggttactccgacagtaacaaagactcaggattt
atgagtagtaactgggaaattcacaaagctcagaaaaatctagcaagaatcggcgataaa
tacggcttaaacattaaaatctttcatggcagaggtggttcagtcggtagaggaggaggc
cccgcttacgccgctattttagcacaacctacatccaccattaacggtagaataaaaatt
accgaacaaggggaagttttagcctctaaatactccttaccagaattagcactgtataac
ctcgaaaccattagcactgcggttattcaagctagtttattaggcagtggattcgatgat
attgagccttggaatgaaatcatggaagaaatctccgttgcttcccgtaaggcttaccgt
caactaatttacgaacaaccagacttcctcgacttcttcttatctgttactcccattgaa
gaaatcagtaaattacaaataagttcacgtcccgctcgtcgtagtagtggcaaaaaagat
atatcatccttaagagcgattccttgggtatttagttggacacaaagccgtttcttactt
cctgcttggtatggtgtcggcacagcattacagcaatttttagatcaagaaccagaagaa
aacttaaaattattaagatatttctatcttaaatggcctttcttcaaaatggtgatttct
aaagtagagatgacactttctaaggttgatttacaaatggcgagtcactatatcgaagaa
ttagcaaaacctgaagataaagagcgtttcttaaaggtatttaaccaaattgcgaaagaa
tactacttaagtcgagaaatggtgctaaaaatcaacgaacagggcagattattagataat
gatcccgatttacaacggtctgtacaattgagaaatggtacgattgtaccattaggtttt
ttacaagtatcgttattaaaacgcctgagacaatacgccaatcaaaacaaagcaggtttg
attcatttccgttacagcaaagaggagttattgcggggagcattgttaaccattaacggt
atcgccgcaggaatgcgtaacaccggttaa

DBGET integrated database retrieval system