KEGG   Croceibacter atlanticus: CA2559_02000Help
Entry
CA2559_02000      CDS       T01256                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cat  Croceibacter atlanticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2559_02000
  Amino acid metabolism
   00310 Lysine degradation
    CA2559_02000
   00380 Tryptophan metabolism
    CA2559_02000
Enzymes [BR:cat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CA2559_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
491883..494645
Genome map
AA seq 920 aa AA seqDB search
MDQFSFLNAAHTSYFADLYDQYLKYPDSVEPSWRAFFQGFDLGLEERGDIEATQANTSNS
KSASQAPDAVLKEFQVIRLIDGYRARGHLFTKTNPVRERRKYVPTLDISNFGLSEQDLDL
KFNAGNIIGIGEASLRDIITHLERIYCEAIGVEYMYVRKPEEIQWIQDKLNINDNHPEFS
NDQKKHILKKLNEAVSFESFLHRKYVGQKRFSLEGNESLIPALDALIENAAEQGVEDFVM
GMAHRGRLSTLTNIFGKSAKDIFSEFDGKDYEQEVFDGDVKYHLGWTACRKTDSGKEINL
NIAPNPSHLETVGAVVEGITRAKQDRHHKDDFSKVLPIVVHGDAAIAGQGIVYEIVQMSQ
LDGYKTNGTIHIVVNNQIGFTTNYLDGRSSTYCTDVAKVTLSPVLHVNADDAEAVVHAML
FALDFRMRFKRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHKNPLEIYAEKLKSQG
VIDDSYVTKLEQDYKNKLEENLEDSRKEDKTEITAIMKDEWEGFNYAQEDEMMTPVDTTY
DLEKLTEIAEVITELPKDKKFLRKIAKLIEARKTMYFEDNKLDWAMGELLAYGTLLKEGY
DVRMTGQDVERGTFSHRHAVVKVEESEEEILLLNNLKGDQGDFYIYNSLLSEYAVVGFDY
GYAMASPKTLTIWEAQFGDFSNGAQIMLDQYISAAEDKWKLQNGLVMLLPHGYEGQGAEH
SSARMERYLQLCAKDNMYVADCTTPANLYHLFRRQMKTDFRKPLIVFTPKSLLRHPKVVS
TKEEIANGAFQMTIDDVEADAKKVKTLVFCTGKFFYDLTAERDDNKRDDIAFVRVEQLFP
LPVEEMRNAMKKYSNAKDVVWAQEEPRNMGAYSHILMHLDEAKSFRVCSRRPYGAPAAGS
SVRFKKRHAKVIEDVFTRPE
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggatcaattttcatttctcaacgcggcacatacatcttattttgccgacctttacgac
cagtacctaaaatatccagatagcgtagagccaagctggcgcgctttctttcaaggtttt
gacctaggattagaagaacgtggcgatatagaagcaactcaggctaacactagcaactct
aaatctgcatctcaagcaccagatgctgttttaaaagagtttcaagttatacgtctaatt
gatggctatagagcaagaggacatcttttcactaagacaaatcctgttagggaaagacgt
aagtacgtcccaacactagatatttcaaactttggactttctgagcaagacttagacctt
aaatttaatgctggtaatattattggcattggcgaagcttctttgcgagacattattaca
catctagaacgcatttattgcgaagctattggtgtagaatatatgtacgtaagaaaaccc
gaagaaatacagtggatacaggacaagttaaatattaacgacaaccacccagagttttct
aacgatcaaaaaaagcacattcttaaaaaattgaatgaagctgtatcgtttgaatcattc
ttacacagaaaatatgttggccagaaaagattttcattagaaggtaatgaaagtttaatt
cctgccttagatgcattaattgaaaatgccgcagagcaaggtgttgaagattttgttatg
ggaatggcgcatagaggtcgccttagcacgcttaccaacatttttggaaagagcgcaaaa
gacatctttagtgagtttgatggtaaagattacgaacaggaagtttttgatggtgatgtt
aaatatcaccttggatggacagcctgcagaaaaaccgacagtggtaaagaaataaattta
aatatagcaccaaacccttcacacctagaaacagtaggtgcagttgttgaaggtataaca
cgtgcaaaacaagatcgccatcacaaagacgattttagcaaagtattacctattgtagtt
cacggtgatgccgcaattgcaggacaaggtattgtttatgaaatagtacaaatgtctcag
ctagatggctataaaactaatggtacaattcatattgttgtaaacaatcaaattgggttt
accactaactacctagatggccgctcatcaacttattgtacagatgttgctaaagtaaca
ttgtctcctgtacttcacgttaatgcagacgatgcagaagctgtggtgcacgccatgtta
tttgcgctagattttagaatgaggtttaaacgcgatgtgtttatagatcttttaggttat
agaaaatatggccataacgaaggagatgaaccacgctttacacaacctaagttatacaaa
gccatctctaaacacaaaaaccctttagaaatttatgctgaaaagctaaaatctcaaggc
gttatagatgatagctatgtaacaaaacttgaacaagattataaaaataaattagaggaa
aatcttgaggattctcgtaaagaggacaaaacagaaattaccgctataatgaaagatgag
tgggaaggctttaattatgctcaagaagatgagatgatgacgccggttgataccacttat
gatttagaaaaacttactgaaattgctgaggtaattacagaacttcctaaggataaaaaa
ttcctaagaaagattgctaagctaatagaggctcgtaaaaccatgtattttgaggacaac
aaactcgattgggcaatgggagagcttttagcttacggaacgcttttaaaagaaggttat
gacgtgaggatgacaggtcaagatgttgagcgtggtacattctctcaccgtcatgcagtt
gtgaaagttgaagagagtgaagaagaaattttattgctcaacaacttaaaaggtgatcaa
ggtgacttctacatatacaattctttgttgtctgaatatgctgttgtaggttttgattac
ggttacgccatggcaagcccaaaaacattaactatctgggaagcacaatttggagatttc
tcaaatggtgctcaaataatgttagaccaatacatttctgctgcagaagacaagtggaaa
ctacaaaatggtcttgtaatgttattaccacacggttatgaaggccaaggtgcagaacac
tcatcggctagaatggagcgttacttacaattatgtgctaaagacaatatgtatgttgca
gattgtacaacgccagcaaacctttatcatttgtttagaagacaaatgaaaacagatttt
agaaagcctttaattgtatttacacctaaaagtttattacgtcaccccaaagtagtgtct
actaaagaagaaattgcaaatggagcattccaaatgacaattgatgatgttgaggcagac
gctaaaaaagttaaaacattagtattttgcaccggtaaattcttttatgatcttactgca
gaacgcgatgataataaaagagatgacattgcatttgtaagagtagaacagcttttccca
cttcccgtagaggagatgagaaatgctatgaaaaaatacagcaatgcaaaagatgttgtt
tgggctcaagaagaaccaagaaacatgggagcttatagccacatcttaatgcacttagat
gaagcaaaatcatttagagtatgcagcagaagaccttatggtgcacctgcagcaggaagt
tcagtaaggtttaagaaacgtcatgctaaggttatagaagatgtttttacaagacctgaa
taa

DBGET integrated database retrieval system