KEGG   Cercocebus atys (sooty mangabey): 105585038
Entry
105585038         CDS       T07242                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty01521  EGFR tyrosine kinase inhibitor resistance
caty01522  Endocrine resistance
caty04010  MAPK signaling pathway
caty04012  ErbB signaling pathway
caty04014  Ras signaling pathway
caty04015  Rap1 signaling pathway
caty04062  Chemokine signaling pathway
caty04068  FoxO signaling pathway
caty04071  Sphingolipid signaling pathway
caty04072  Phospholipase D signaling pathway
caty04137  Mitophagy - animal
caty04140  Autophagy - animal
caty04150  mTOR signaling pathway
caty04151  PI3K-Akt signaling pathway
caty04210  Apoptosis
caty04211  Longevity regulating pathway
caty04213  Longevity regulating pathway - multiple species
caty04218  Cellular senescence
caty04360  Axon guidance
caty04370  VEGF signaling pathway
caty04371  Apelin signaling pathway
caty04540  Gap junction
caty04550  Signaling pathways regulating pluripotency of stem cells
caty04625  C-type lectin receptor signaling pathway
caty04650  Natural killer cell mediated cytotoxicity
caty04660  T cell receptor signaling pathway
caty04662  B cell receptor signaling pathway
caty04664  Fc epsilon RI signaling pathway
caty04714  Thermogenesis
caty04720  Long-term potentiation
caty04722  Neurotrophin signaling pathway
caty04725  Cholinergic synapse
caty04726  Serotonergic synapse
caty04730  Long-term depression
caty04810  Regulation of actin cytoskeleton
caty04910  Insulin signaling pathway
caty04912  GnRH signaling pathway
caty04914  Progesterone-mediated oocyte maturation
caty04915  Estrogen signaling pathway
caty04916  Melanogenesis
caty04917  Prolactin signaling pathway
caty04919  Thyroid hormone signaling pathway
caty04921  Oxytocin signaling pathway
caty04926  Relaxin signaling pathway
caty04929  GnRH secretion
caty04933  AGE-RAGE signaling pathway in diabetic complications
caty04935  Growth hormone synthesis, secretion and action
caty04960  Aldosterone-regulated sodium reabsorption
caty05010  Alzheimer disease
caty05022  Pathways of neurodegeneration - multiple diseases
caty05034  Alcoholism
caty05160  Hepatitis C
caty05161  Hepatitis B
caty05163  Human cytomegalovirus infection
caty05165  Human papillomavirus infection
caty05166  Human T-cell leukemia virus 1 infection
caty05167  Kaposi sarcoma-associated herpesvirus infection
caty05170  Human immunodeficiency virus 1 infection
caty05200  Pathways in cancer
caty05203  Viral carcinogenesis
caty05205  Proteoglycans in cancer
caty05206  MicroRNAs in cancer
caty05207  Chemical carcinogenesis - receptor activation
caty05208  Chemical carcinogenesis - reactive oxygen species
caty05210  Colorectal cancer
caty05211  Renal cell carcinoma
caty05212  Pancreatic cancer
caty05213  Endometrial cancer
caty05214  Glioma
caty05215  Prostate cancer
caty05216  Thyroid cancer
caty05218  Melanoma
caty05219  Bladder cancer
caty05220  Chronic myeloid leukemia
caty05221  Acute myeloid leukemia
caty05223  Non-small cell lung cancer
caty05224  Breast cancer
caty05225  Hepatocellular carcinoma
caty05226  Gastric cancer
caty05230  Central carbon metabolism in cancer
caty05231  Choline metabolism in cancer
caty05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
caty05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:caty00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105585038 (KRAS)
   04012 ErbB signaling pathway
    105585038 (KRAS)
   04014 Ras signaling pathway
    105585038 (KRAS)
   04015 Rap1 signaling pathway
    105585038 (KRAS)
   04370 VEGF signaling pathway
    105585038 (KRAS)
   04371 Apelin signaling pathway
    105585038 (KRAS)
   04068 FoxO signaling pathway
    105585038 (KRAS)
   04072 Phospholipase D signaling pathway
    105585038 (KRAS)
   04071 Sphingolipid signaling pathway
    105585038 (KRAS)
   04151 PI3K-Akt signaling pathway
    105585038 (KRAS)
   04150 mTOR signaling pathway
    105585038 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105585038 (KRAS)
   04137 Mitophagy - animal
    105585038 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105585038 (KRAS)
   04218 Cellular senescence
    105585038 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105585038 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105585038 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105585038 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105585038 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    105585038 (KRAS)
   04660 T cell receptor signaling pathway
    105585038 (KRAS)
   04662 B cell receptor signaling pathway
    105585038 (KRAS)
   04664 Fc epsilon RI signaling pathway
    105585038 (KRAS)
   04062 Chemokine signaling pathway
    105585038 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105585038 (KRAS)
   04929 GnRH secretion
    105585038 (KRAS)
   04912 GnRH signaling pathway
    105585038 (KRAS)
   04915 Estrogen signaling pathway
    105585038 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    105585038 (KRAS)
   04917 Prolactin signaling pathway
    105585038 (KRAS)
   04921 Oxytocin signaling pathway
    105585038 (KRAS)
   04926 Relaxin signaling pathway
    105585038 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    105585038 (KRAS)
   04919 Thyroid hormone signaling pathway
    105585038 (KRAS)
   04916 Melanogenesis
    105585038 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105585038 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105585038 (KRAS)
   04726 Serotonergic synapse
    105585038 (KRAS)
   04720 Long-term potentiation
    105585038 (KRAS)
   04730 Long-term depression
    105585038 (KRAS)
   04722 Neurotrophin signaling pathway
    105585038 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105585038 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105585038 (KRAS)
   04213 Longevity regulating pathway - multiple species
    105585038 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105585038 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105585038 (KRAS)
   05206 MicroRNAs in cancer
    105585038 (KRAS)
   05205 Proteoglycans in cancer
    105585038 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    105585038 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105585038 (KRAS)
   05203 Viral carcinogenesis
    105585038 (KRAS)
   05230 Central carbon metabolism in cancer
    105585038 (KRAS)
   05231 Choline metabolism in cancer
    105585038 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105585038 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105585038 (KRAS)
   05212 Pancreatic cancer
    105585038 (KRAS)
   05225 Hepatocellular carcinoma
    105585038 (KRAS)
   05226 Gastric cancer
    105585038 (KRAS)
   05214 Glioma
    105585038 (KRAS)
   05216 Thyroid cancer
    105585038 (KRAS)
   05221 Acute myeloid leukemia
    105585038 (KRAS)
   05220 Chronic myeloid leukemia
    105585038 (KRAS)
   05218 Melanoma
    105585038 (KRAS)
   05211 Renal cell carcinoma
    105585038 (KRAS)
   05219 Bladder cancer
    105585038 (KRAS)
   05215 Prostate cancer
    105585038 (KRAS)
   05213 Endometrial cancer
    105585038 (KRAS)
   05224 Breast cancer
    105585038 (KRAS)
   05223 Non-small cell lung cancer
    105585038 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105585038 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    105585038 (KRAS)
   05161 Hepatitis B
    105585038 (KRAS)
   05160 Hepatitis C
    105585038 (KRAS)
   05163 Human cytomegalovirus infection
    105585038 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105585038 (KRAS)
   05165 Human papillomavirus infection
    105585038 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105585038 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105585038 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    105585038 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105585038 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105585038 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105585038 (KRAS)
   01522 Endocrine resistance
    105585038 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:caty04131]
    105585038 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:caty04031]
    105585038 (KRAS)
Membrane trafficking [BR:caty04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105585038 (KRAS)
GTP-binding proteins [BR:caty04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105585038 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 105585038
NCBI-ProteinID: XP_011913652
Ensembl: ENSCATG00000030021
UniProt: A0A2K5LFF0
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system