KEGG   Chloroflexus aurantiacus: Caur_3161Help
Entry
Caur_3161         CDS       T00639                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cau  Chloroflexus aurantiacus
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Caur_3161
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Caur_3161
   00680 Methane metabolism
    Caur_3161
Enzymes [BR:cau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Caur_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4241846..4244665)
Genome map
AA seq 939 aa AA seqDB search
MSGRTTANEHDLLSANIRALGDALGRVIIGQHGSEALALVEQVRRMAKDLRNAPTNTDPQ
ALPQLIADLDLPQLRSLVKAFTLYFGLVNLAEGVERLRVLRARDLRHAPAPRAESIADAI
ELLKRHGVPAPAIQEWLDHALIMPVLTAHPTESRRRTILIKLRRIFDTLVDLTFGERLVL
PADRQAALTRIEREIVGLWQSDDVRNRRPSVLDEVENGLFFFQTVLWELLPHIYREMSDA
LQAAYPDHPWRLPPFLRFGSWMGGDRDGNPFVTPEVTVETVRLMRSAMLRYLIDCLDRLI
TDLSQSVQQVKVDTAIIDRIAEYRELMPDAAATLNPHYRCEPYRQLCHFIQARLHNTLQY
TLDYTPRWGIDPPLARRPDIYYHSRELLADLDLIDASLRNNGSTLIAEGLLRDVRTLVAV
CHLHTATLDVRQHASRHTAALSEILAAAGVVDDYEALDEAERIAVLSVEIRRPRPLTPSR
LSHFSPATAETIHTFRVIAAISEQLDPEIFQTYIISTTSQVSDLLAVLLLCRDAGLYQPG
QASQLHIVPLFETGDDLQRAPALLDELLRLPVYREHLALRDNLQEVMLGYSDSNKEGGFV
AANWALYRAQVELTAVTDRHGVRLRLFHGRGGAVGRGGAVGRGGGPAGQAILAQPPGTLH
GQIKVTDQGEMISDRYLDPRTAHRHLEQVVNAVLRAGFPGMARQPEPTWLAAMEEMATTA
RTVYRQLVYEDPDFLIYFRSATPVAEFNRLRIGSRPVSRRKSDRIEDLRAIPWVFSWMQS
RHTIPGWFGLGSALEAFVEADPHHLHLLRTMYQHWPFFSTLLDNAQMIMLKADMNIARAY
ASLVPDRHLAERIFQRIESEFRRTERMICQITERNDLLAHQPVLQRAIRQRNPYIDPLSF
VQIELLRRLRAAPPEEQGELETVLLMSINGIAAGLKNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacgaaccactgctaacgaacatgatctgttatcggcaaacattcgcgcacta
ggcgatgcacttggccgggtcattatcggtcaacacggtagcgaagcactggcactggtg
gaacaggtgcgccggatggctaaagacctccgcaatgcaccaaccaacaccgatccacag
gcacttccccaattgattgccgatctggatttgccacaattacgcagtctggtcaaggca
ttcacgctctattttggattggtcaatctggcggaaggggttgaacgtctgcgcgttttg
cgggcgcgcgatctacgccatgcgcccgccccccgtgccgagagtattgccgacgctatc
gaattgctgaagcgtcacggagtaccggcacctgcgatccaggaatggctggatcacgcg
ctgattatgccggtgttgacggcgcacccgaccgagtcgcgccggcgcacaatcctgatt
aaactgcggcgcatttttgatacgctggtcgatttgacatttggagagcggttggtctta
cctgccgaccggcaggccgcgcttacccgcatcgagcgggagatcgtcgggttgtggcag
agcgatgatgtgcgtaatcggcgaccatcggtgctcgacgaagtggagaatggactgttc
ttctttcaaaccgtcctctgggaactcctaccgcacatctatcgtgagatgagtgatgcg
ctgcaagcagcatatccggatcacccctggcgtctgccgccatttctgcgctttggaagc
tggatgggcggggatcgcgacggcaatcccttcgtgacgccagaggtaacggtcgagacg
gtacggctgatgcggagcgcaatgctgcgttatctgatagattgccttgatcggctgatc
accgatttgagccaatcggtgcagcaggtgaaggtggatacggcgatcattgatcgcatc
gccgaatatcgcgagttgatgccagatgcagcagcgacgctcaacccgcattaccgctgc
gagccataccgccagttgtgccattttattcaggcccggctgcacaacacccttcagtac
acgttggactacacgcctcgttgggggatcgatccaccgctcgcacggcgacccgacatc
tactaccatagccgcgaactcttagccgatctcgacctgatcgatgccagtctgcgcaat
aacggcagtacgttaatcgccgagggtctgttgcgcgatgtacgaacgctcgtggcagtt
tgccatctgcacacggccaccctcgacgtgcgccagcacgccagccggcacacagcagcc
ctgagcgaaatcctggccgctgctggtgtggtcgacgattacgaagcgctcgatgaggca
gagcggattgcggtgttgagcgtggaaattcgccgaccgcgcccactcacgcccagccga
ctcagtcatttcagtccggcgacggcggaaaccattcacacctttcgggtcatagcggca
atcagcgaacagctcgacccagaaatctttcagacgtacatcatctcgaccaccagtcag
gtcagcgatctgctggcagtgttgctgctctgccgcgatgccggtctctaccagcccggt
caggccagtcagttgcatattgtgccgctgtttgaaacgggtgacgacctgcaacgcgca
ccggcgctcctggatgaactgctccgcttgccggtgtaccgtgagcatctggcgctacgc
gacaacctgcaagaggtgatgctcggttattccgacagcaacaaagagggtggctttgtg
gctgcaaactgggcactctaccgggcacaggtggaactgacagcggtcacagatcggcac
ggcgtccgcttgcgcctcttccatggccgcggtggcgctgttggccgcggtggcgctgtt
ggccgcggtggcggccctgccggacaggccatcctcgcccaaccacccggaaccctccac
ggtcagatcaaggttactgaccagggtgaaatgatctcagaccgttatctcgatccgcgg
actgcccatcgtcacctcgaacaggtggttaatgccgtgttgcgggcgggctttcccggc
atggcgcggcagcccgaaccaacctggctggccgcgatggaggagatggcgactacggca
cgtactgtctaccggcaactggtttacgaagacccggattttctgatctattttcgcagt
gccacaccggtggccgaattcaaccggctacgcatcggctcacgtccggtctcgcgccgc
aagagtgatcggatcgaagacctgcgggccattccatgggtctttagctggatgcagagt
cggcacacgattccgggctggtttggcctgggcagtgcgctggaagcatttgtggaagcc
gatccgcatcacctgcatctattgcgcaccatgtaccagcactggccctttttcagcacg
ctgctggataacgcgcagatgatcatgctgaaagccgatatgaacattgcccgcgcttac
gccagcctggtgccggatcgtcatctggccgaacggatctttcagcggatcgagagcgaa
ttccgccgcaccgaacgtatgatctgtcagatcaccgaacgcaacgatctgttggcccat
caaccggtacttcagcgggcgattcggcagcgcaacccgtacatcgatccactcagcttt
gtccagattgaactgctccgccgattgcgcgctgcgccgcccgaagaacagggcgaattg
gaaacggttttgttgatgtcaatcaacggcattgctgccggattgaagaatacaggctga

DBGET integrated database retrieval system