KEGG   Corynebacterium atypicum: CATYP_10060Help
Entry
CATYP_10060       CDS       T03227                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cax  Corynebacterium atypicum
Brite
Enzymes [BR:cax01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CATYP_10060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2221919..2222524
Genome map
AA seq 201 aa AA seqDB search
MAVYELPDLPYAYDALEPHISGEIMQLHHDKHHQTYVDGANSALEALEKAREEGCDQNTI
RALSKNLAFNLGGHTNHSIFWKNLSPNGGGSEPTGELAEAINRDFGSFEKFKDHFSNAAL
SLQGSGWAVLGYDHVAGRLVIEQMTDQQGNLSINLTPLLLLDMWEHAFYLQYKNVKADYV
KAVWNVFNWDDVAERFAAAKK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttacgagcttcccgatcttccttacgcttacgacgccctggagccgcacatc
tccggcgagatcatgcagctgcaccacgataagcaccaccagacctacgtcgacggcgcg
aactccgccctcgaggccctggagaaggcccgcgaggaaggctgcgaccagaacaccatc
cgcgcgctgtctaagaaccttgcgtttaacctgggtggccacacgaaccactccatcttc
tggaagaacctttccccgaacggcggcggcagcgagcccaccggcgagctggctgaggct
atcaaccgcgacttcgggtccttcgagaagtttaaggatcacttctctaacgcggcgctt
tccctgcagggctccggctgggccgtcctcggctacgatcacgtcgccggccggttggtc
atcgagcagatgacggatcagcagggcaacctctcgatcaacctcaccccgctgctgctg
ctcgacatgtgggagcacgccttctacctgcagtacaagaacgtcaaggctgactacgtc
aaggccgtctggaacgtctttaactgggatgacgtcgccgagcgcttcgccgcagcgaag
aagtaa

DBGET integrated database retrieval system