Camelus bactrianus (Bactrian camel): 105070689 Help Entry 105070689         CDS       T07534                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai01523   Antifolate resistance cbai04010   MAPK signaling pathway cbai04014   Ras signaling pathway cbai04024   cAMP signaling pathway cbai04062   Chemokine signaling pathway cbai04064   NF-kappa B signaling pathway cbai04066   HIF-1 signaling pathway cbai04071   Sphingolipid signaling pathway cbai04137   Mitophagy - animal cbai04151   PI3K-Akt signaling pathway cbai04210   Apoptosis cbai04211   Longevity regulating pathway cbai04218   Cellular senescence cbai04380   Osteoclast differentiation cbai04613   Neutrophil extracellular trap formation cbai04620   Toll-like receptor signaling pathway cbai04621   NOD-like receptor signaling pathway cbai04622   RIG-I-like receptor signaling pathway cbai04623   Cytosolic DNA-sensing pathway cbai04625   C-type lectin receptor signaling pathway cbai04657   IL-17 signaling pathway cbai04658   Th1 and Th2 cell differentiation cbai04659   Th17 cell differentiation cbai04660   T cell receptor signaling pathway cbai04662   B cell receptor signaling pathway cbai04668   TNF signaling pathway cbai04722   Neurotrophin signaling pathway cbai04917   Prolactin signaling pathway cbai04920   Adipocytokine signaling pathway cbai04926   Relaxin signaling pathway cbai04931   Insulin resistance cbai04932   Non-alcoholic fatty liver disease cbai04933   AGE-RAGE signaling pathway in diabetic complications cbai04936   Alcoholic liver disease cbai05010   Alzheimer disease cbai05022   Pathways of neurodegeneration - multiple diseases cbai05030   Cocaine addiction cbai05132   Salmonella infection cbai05133   Pertussis cbai05134   Legionellosis cbai05135   Yersinia infection cbai05140   Leishmaniasis cbai05142   Chagas disease cbai05145   Toxoplasmosis cbai05146   Amoebiasis cbai05152   Tuberculosis cbai05160   Hepatitis C cbai05161   Hepatitis B cbai05162   Measles cbai05163   Human cytomegalovirus infection cbai05164   Influenza A cbai05165   Human papillomavirus infection cbai05166   Human T-cell leukemia virus 1 infection cbai05167   Kaposi sarcoma-associated herpesvirus infection cbai05168   Herpes simplex virus 1 infection cbai05169   Epstein-Barr virus infection cbai05170   Human immunodeficiency virus 1 infection cbai05171   Coronavirus disease - COVID-19 cbai05200   Pathways in cancer cbai05202   Transcriptional misregulation in cancer cbai05203   Viral carcinogenesis cbai05207   Chemical carcinogenesis - receptor activation cbai05208   Chemical carcinogenesis - reactive oxygen species cbai05212   Pancreatic cancer cbai05215   Prostate cancer cbai05220   Chronic myeloid leukemia cbai05221   Acute myeloid leukemia cbai05222   Small cell lung cancer cbai05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cbai05321   Inflammatory bowel disease cbai05415   Diabetic cardiomyopathy cbai05417   Lipid and atherosclerosis cbai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105070689 (RELA)    04014 Ras signaling pathway     105070689 (RELA)    04064 NF-kappa B signaling pathway     105070689 (RELA)    04668 TNF signaling pathway     105070689 (RELA)    04066 HIF-1 signaling pathway     105070689 (RELA)    04071 Sphingolipid signaling pathway     105070689 (RELA)    04024 cAMP signaling pathway     105070689 (RELA)    04151 PI3K-Akt signaling pathway     105070689 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105070689 (RELA)   09143 Cell growth and death    04210 Apoptosis     105070689 (RELA)    04218 Cellular senescence     105070689 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105070689 (RELA)    04620 Toll-like receptor signaling pathway     105070689 (RELA)    04621 NOD-like receptor signaling pathway     105070689 (RELA)    04622 RIG-I-like receptor signaling pathway     105070689 (RELA)    04623 Cytosolic DNA-sensing pathway     105070689 (RELA)    04625 C-type lectin receptor signaling pathway     105070689 (RELA)    04660 T cell receptor signaling pathway     105070689 (RELA)    04658 Th1 and Th2 cell differentiation     105070689 (RELA)    04659 Th17 cell differentiation     105070689 (RELA)    04657 IL-17 signaling pathway     105070689 (RELA)    04662 B cell receptor signaling pathway     105070689 (RELA)    04062 Chemokine signaling pathway     105070689 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105070689 (RELA)    04917 Prolactin signaling pathway     105070689 (RELA)    04926 Relaxin signaling pathway     105070689 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105070689 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     105070689 (RELA)   09149 Aging    04211 Longevity regulating pathway     105070689 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105070689 (RELA)    05202 Transcriptional misregulation in cancer     105070689 (RELA)    05207 Chemical carcinogenesis - receptor activation     105070689 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     105070689 (RELA)    05203 Viral carcinogenesis     105070689 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105070689 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     105070689 (RELA)    05221 Acute myeloid leukemia     105070689 (RELA)    05220 Chronic myeloid leukemia     105070689 (RELA)    05215 Prostate cancer     105070689 (RELA)    05222 Small cell lung cancer     105070689 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105070689 (RELA)    05170 Human immunodeficiency virus 1 infection     105070689 (RELA)    05161 Hepatitis B     105070689 (RELA)    05160 Hepatitis C     105070689 (RELA)    05171 Coronavirus disease - COVID-19     105070689 (RELA)    05164 Influenza A     105070689 (RELA)    05162 Measles     105070689 (RELA)    05168 Herpes simplex virus 1 infection     105070689 (RELA)    05163 Human cytomegalovirus infection     105070689 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     105070689 (RELA)    05169 Epstein-Barr virus infection     105070689 (RELA)    05165 Human papillomavirus infection     105070689 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105070689 (RELA)    05135 Yersinia infection     105070689 (RELA)    05133 Pertussis     105070689 (RELA)    05134 Legionellosis     105070689 (RELA)    05152 Tuberculosis     105070689 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     105070689 (RELA)    05145 Toxoplasmosis     105070689 (RELA)    05140 Leishmaniasis     105070689 (RELA)    05142 Chagas disease     105070689 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     105070689 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     105070689 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     105070689 (RELA)   09165 Substance dependence    05030 Cocaine addiction     105070689 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105070689 (RELA)    05418 Fluid shear stress and atherosclerosis     105070689 (RELA)    05415 Diabetic cardiomyopathy     105070689 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105070689 (RELA)    04932 Non-alcoholic fatty liver disease     105070689 (RELA)    04931 Insulin resistance     105070689 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     105070689 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105070689 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cbai03000]     105070689 (RELA) Transcription factors [BR:cbai03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     105070689 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Cuticle_3 Motif Other DBs NCBI-GeneID:  105070689 NCBI-ProteinID:  XP_010955442 UniProt:  A0A9W3ETA5 LinkDB All DBs Position Unknown AA seq 553 aa AA seqDB search MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPSRSSASIPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTSALAPAPAPVLAQTSAPAPAPAMASALAQAPAPVPVLAPGLAQ AVAPPAPKTNQAGEGTLTEALLQLQFDADEDLGALLGNNNDTAVFTDLASVDNSEFQQLL TQGVPIAPHAAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSGDEDFSSIA DMDFSALLSQIGS NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt atggacgacctcttccctctcatcttcccggcggagccagcccaggcctctggtccctat gtggagatcatcgagcagcccaagcagcggggcatgcgctttcgctacaagtgcgagggc cgctcagcaggcagtatcccaggagagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac ccccctcaccggccccacccccatgagctcgtggggaaagactgccgggatggcttctat gaggctgagctctgccccgaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcagcgcatccagaccaacaataacccc ttccaagttcctatagaagagcagcgcggggactacgacctgaatgctgtgcgcctctgc ttccaggtgacagtgcgggacccagcagggaggcccctccgcctgtcacctgtcctctct catcctatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaat cgaaactctgggagctgccttgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagctgatgtgcaccgacaagtggccattgttttccggacacccccctacgcagacccc agcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgaccgtcaccggattgaggag aaacgcaaaagaacatacgagacctttaagagcatcatgaaaaagagccctttcaatggc cccaccgacccccggcctccaacccggcgcattgctgtgccttcccgcagctcagcttcc atccccaagccagctccccagccctatccatttacaccatctctcagcaccatcaatttt gaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggccttg gcaccagcccctgccccagtcctggcccagacctcagcccctgcccctgccccagccatg gcatcagccctggcccaggccccagcccctgtcccagtcctagccccaggccttgctcag gctgtggccccgcctgcccccaagaccaaccaggctggggaagggacactgacagaggcc ctgctgcagctgcagtttgatgctgatgaagacctgggggccctgcttggcaataacaac gacacagccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagctgctg acccagggtgtacccatagccccccacgcagctgagcccatgttgatggagtaccctgag gctataactcgcctggtgaccgggtcccagaggccccctgacccagctcccacccccctg ggcgcctctgggctcaccaacggcctcctctcgggggatgaagacttctcttccattgcg gacatggacttctcagcccttctgagtcagatcggctcctaa

DBGET integrated database retrieval system