KEGG   Clostridium botulinum B1 Okra: CLD_0228Help
Entry
CLD_0228          CDS       T00671                                 

Definition
(GenBank) superoxide dismutase, Mn/Fe family
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbb  Clostridium botulinum B1 Okra
Brite
Enzymes [BR:cbb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLD_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(642134..642784)
Genome map
AA seq 216 aa AA seqDB search
MIVAKKYPFDNVKGISLKQLTEHYKLYDGYVNTINKIWSIPNNSKDFKDSNATFSKLRCI
KLGESYALDGVKLHQLYFQNMTSGYVPINGPILDKILEDFNSVENFTELFKETGKSMRGW
VVLGIDPLSNKLHIFGSDAHDNGAIWLSYPLLVMDVYEHAYFMDFGTDKEKYMDAFLQNV
NWNLINNRLGMYYTLINALKHNILLNNKMKHRNMFY
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgattgttgctaaaaaatatccttttgataatgtaaaaggaataagtttaaaacaacta
acggaacattataaattatatgatggttatgtaaatacgataaataaaatttggagtata
cctaacaattctaaagattttaaagatagtaatgccacttttagtaaattaagatgcata
aaattaggggaaagttatgctttagatggcgttaaattacatcaactatattttcaaaat
atgacttctggatatgtccctataaatggacccatactagataaaatcctagaagatttt
aattccgtagaaaatttcacggaactatttaaagagactggtaagtctatgagaggctgg
gttgtattaggtatagatcctttaagtaataaacttcacatttttggctctgatgctcac
gataatggtgccatatggctttcctatccattgcttgtaatggatgtgtatgagcatgct
tattttatggattttggaacagataaagagaaatatatggatgcttttcttcaaaacgta
aactggaatttaataaataacagattaggtatgtactataccctaataaatgctttaaaa
cataatatacttttaaataacaaaatgaagcacagaaatatgttttattaa

DBGET integrated database retrieval system