KEGG   Clostridium botulinum B1 Okra: CLD_2279Help
Entry
CLD_2279          CDS       T00671                                 

Gene name
tgl
Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
cbb  Clostridium botulinum B1 Okra
Brite
Enzymes [BR:cbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     CLD_2279 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2483631..2484452)
Genome map
AA seq 273 aa AA seqDB search
MIKISGNIVTRDKIVAKYPPNSLERKIAEQLSSNQDVHNYDSLNQLEFDIKLRANIVESA
RELDRSDLSFTTFRRSRCNRDYWQRTDEGGFLLKEHVKASDAIKDIFINTSKYGTECATA
IVIIYYKALLNVLPEKLFNEMFPSIYLFDWQYLNRNLHVESYGGVTEFFPGDCQYFKNPD
VNPATPEWQGENVINLGDGTYYGHGIGITSANGIIRELNRNRRRGATESAFLTDSVTRLN
SREIFDKYYNFSSTMRIKRCREIHRGYPNYLYY
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatttcaggtaatatagttaccagagataaaattgttgctaaatatccaccc
aatagcctggaaagaaagattgccgagcagttatcatcgaatcaagatgttcataactat
gactcgctaaatcaattagagtttgacataaaactaagagcaaatattgttgagtcagcc
agggaattagatagaagcgatttgagttttacaacctttcgtagatccagatgtaataga
gattactggcagcgcactgatgaaggtggctttttattaaaagaacatgtaaaggcatct
gatgccataaaggatatctttattaatacttcaaaatatggtactgaatgtgccactgca
atagttattatttattataaggcacttcttaatgtacttcccgaaaaactttttaatgaa
atgtttccaagtatatatttattcgactggcaatatctaaatagaaaccttcatgtggaa
tcatatggaggtgtaacagagttctttcctggagattgtcaatattttaaaaaccctgat
gtaaacccggcaacgcctgaatggcagggagaaaatgttattaatttaggtgatggaact
tattatggccatggtataggtataacaagcgctaatggaataataagagaattaaatagg
aacaggagaaggggagctacagaatcggcttttttaacagattctgtaacgcgtttaaat
tctagggaaatatttgataaatattataattttagttctacaatgcgaataaagagatgt
agagagattcatagaggctatcccaattatctatattattaa

DBGET integrated database retrieval system