KEGG   Clostridium botulinum F Langeland: CLI_3582Help
Entry
CLI_3582          CDS       T00563                                 

Gene name
alr-2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00473  D-Alanine metabolism
cbf01100  Metabolic pathways
cbf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLI_3582 (alr-2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CLI_3582 (alr-2)
Enzymes [BR:cbf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLI_3582 (alr-2)
Peptidoglycan biosynthesis and degradation proteins [BR:cbf01011]
 Precursor biosynthesis
  Racemase
   CLI_3582 (alr-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABS40828
UniProt: A7GIZ4
LinkDB All DBs
Position
complement(3742040..3743200)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDLDNLQHNLKQIKKICGNKEIIGVIKANAYGHGAMEVAPTLLENGVSR
LAVAVLSEAMELRMSGVKESIMILGYTPGALGDMLLDNDIEQSVYSYNDALELSKIAVLK
RKILKIHIVVDTGMGRIGFLPTKESVEDVYKISKLPNIKIEGLFSHFSSADELDKDYTLY
QMNKYNEFINKLEEKNIQVPIKHIANSAAIIDLENTHLDAVRAGIIMYGYYPSNYVLRDN
INLKPVMSLKTSIVHIKKVSSGEYISYGRTFKTERESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTFIENLKVGDVVTIMGEENGVSYTAEDIASQIGTISYE
VICNVNKRVPRVYKKDGKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaatcgatctagataatttacaacataac
ttaaaacaaataaaaaaaatatgtggaaataaagaaataataggggttataaaggctaat
gcatatggacatggagccatggaagtagcccctactcttttagaaaatggagtaagtaga
ttagcagtagcggttttaagtgaggctatggagcttagaatgagtggagtaaaggaatcc
attatgatattaggttatacaccaggggctttaggagatatgcttttagataatgatata
gagcaatctgtatactcttataatgatgccttagaattatctaaaatagcggtgctaaaa
agaaaaatattaaaaatacatatagtggtagatactggtatggggagaattgggttttta
cccacaaaagaaagtgtagaagatgtatataaaataagtaagttgcctaatattaaaata
gagggattattttcccatttttcttctgcggacgaattagacaaagattatactttgtat
caaatgaataagtataatgaatttataaataaattagaagaaaaaaatattcaagtacct
ataaagcatattgctaatagcgcagctataattgatttagaaaatactcatttagatgca
gtaagagcaggtattataatgtatggatactatccgtccaattatgtactaagagataat
ataaatctgaagccagtaatgtctttgaaaaccagtatagtacacataaaaaaagtgtct
tcaggagaatatataagttatggcagaactttcaaaacagagagagaaagcataatagct
accttacctataggttatgcagatggatataatagattattaagcaacaaaggaaaagtt
atagttaatggcaaacttgctccagtaataggaagagtttgtatggatcaatgtatgata
gatgtaacttttatagaaaatttaaaagttggagatgtggttacaattatgggggaggaa
aatggagtaagctatactgcagaggatatagcatcacaaataggcactataagttatgaa
gttatatgtaatgtaaataagagggtaccaagagtatataagaaggatggcaaaattata
aatgtagtaaattacatataa

DBGET integrated database retrieval system