KEGG   Coxiella burnetii RSA 331: COXBURSA331_A2129Help
Entry
COXBURSA331_A2129 CDS       T00632                                 

Definition
(GenBank) acyltransferase family protein
Organism
cbs  Coxiella burnetii RSA 331
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1937460..1940018
Genome map
AA seq 852 aa AA seqDB search
MAEPTLLKVKREVIAPLKSTRTDPSKVETLVELLNLYAQNEPDRPHIYFQNEFGEETIIR
YGELYTRAKEFAQGLVGKGLKPSETVAIMLPTSADFFYSFLGTLMAGGIPVPIYPPFRAD
QIEEYAKREAFILHNAGVRFLITFKRAAALSKLLQSFVPSLLEVTTVKALTDISADLPTL
DIEATDPVLIQYTSGSTGNPKGVLLNHANLLANISAYGKTLNMQSTDAFVSWLPLYHDMG
LIGAWMGSFYHGLPLTLLSPFTFLSRPEKWLWAIHYHRGTISPGPNFAYDLCVKKIEDSD
LEGLDLSSWRVALNGSEMIHPDTLRNFEKRFRKYGFKKEAIFPAYGLAECALGLTFPPLN
RGPNIDRIERLPYEKNNTAVPLTTRDKKYYEFVSCGSVLEGHEIRIVDDNDNRVAERTIG
NIQFKGPSAMQGYYRNSEATMAIYHNGWWATGDLGYLAEGELFITGRKKDLIIKAGRNYH
PTEIEAMASLAEGVRKSCVAAFGVADEKRGTEKLIIVAETKEDKKIHPEIKKEIVDKVIS
QIGIPPDEILLVPPHTLPKTSSGKLRRSSCKQDYLAGKLSRPSRSAFWQTIKLFIKSRAK
KIEKWLINLIKVVFSFYVLILLFFTLPVWLLVIILPRKKAAAAFRFWARSIFRLIFSPIS
IKGKENISGQPMIYVANHGSFIDSVILAGVLPADTNFIGKKELLKTPVIKSFVKQLDLVT
VDRMDFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSYATDVRPFKLGAFKIAAELGKPICP
VAIVGARKILRANQFLVKPAKLEVIIFKPLIPESKEWEEVMRLRKQSRFLIAKYSGEHVL
DLVSAGVLSESE
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacccactttgctcaaagtgaaaagggaagtcatcgcaccgcttaaaagcact
cgcaccgatccttctaaagtcgaaacgttagtcgaactcctcaacctctatgctcaaaat
gagcctgatcgtccgcacatttattttcaaaatgaatttggcgaagaaaccattattcgt
tacggcgaactttatacgagagcaaaagaattcgcccagggtttagttggaaaagggtta
aaacccagtgaaaccgttgccattatgcttcccacgtcggccgattttttttattcattt
ttaggcacattgatggccggcggaatccctgttcctatttatcccccctttcgtgctgat
caaattgaagaatatgccaagcgcgaagcctttatattgcataacgccggcgttcgattc
ttaatcacgttcaaacgcgccgctgcactaagtaaattacttcaatcgtttgttcctagc
ctattagaagtgactaccgtcaaagcattaacggatatatcagcggatttacccacatta
gatattgaagctacagatcctgtgttaatccaatatacctctgggagcacggggaatcca
aaaggggtattgctgaatcatgctaatttattagcgaatataagcgcctatggaaaaacg
ctcaacatgcagtcaacggatgcgttcgtcagttggcttccgctttaccatgatatgggt
ttgatcggcgcttggatgggaagcttttaccatgggttaccgttaactttactttctcct
ttcacttttttatcccgtcctgaaaaatggttatgggcgattcattatcaccgagggact
atatctcccggtcctaatttcgcttacgacctgtgcgtaaaaaaaattgaagatagcgat
cttgagggcttggatttaagttcttggcgagtagctctaaatggatcggaaatgattcat
cctgacaccttgcgtaattttgaaaaacgattcaggaaatatggatttaaaaaagaagcg
atttttcccgcttacggccttgcagaatgtgctttggggctcacttttcctcctttaaat
cgggggccgaatatcgatcgaatcgagcgattgccttatgaaaaaaacaataccgccgta
ccgttaaccacgcgcgataagaaatattatgaattcgtttcctgcggcagtgttttagaa
ggacacgaaatccgtattgtggacgataacgataatcgggttgctgaacgtacgattgga
aatatccagtttaaaggcccctccgccatgcaaggttattaccgtaactcagaagcaacg
atggcgatttatcataatggttggtgggcgacgggagaccttggatatttagccgaagga
gagctttttattactggtcggaagaaagatttaattattaaggccggtcgtaattatcat
cccacagaaatcgaagcaatggctagcctcgctgagggagttcgaaaaagttgtgtggct
gcttttggggtagctgatgaaaaaagagggacggaaaaattaataatagtcgccgaaacg
aaagaagataaaaaaattcatcctgaaataaaaaaagaaatagtagataaagtgatttca
caaatcggcatcccgcctgacgaaattttattagtgcctccgcacaccttgccgaaaaca
tccagtggaaaattgcgtcgttcgagttgtaagcaagattatttggccggaaaattaagt
cgaccaagccggtctgctttttggcaaacgataaaattatttattaaaagtcgtgcgaaa
aaaatagaaaaatggttaattaatttgattaaagtggtatttagtttttatgttctcatt
ttattgtttttcaccttacctgtttggttgttagtcattattctgcctcgaaaaaaagca
gccgccgcttttcggttttgggcgcgttcaatttttcggctcatattttctcccatttct
attaaaggaaaagaaaatattagcggacaaccgatgatttatgtcgctaatcatggcagt
tttatagatagcgtgatacttgctggtgtattgccggccgacaccaattttatcggtaaa
aaagaattgttaaaaacacccgtcataaaaagcttcgtcaagcaacttgacctcgtcacg
gttgatcgcatggatttttcaaaaagccattctgatgtgaaacgaattgagcagacattg
gaacaaggccgttccgtccttatttttcctgaagggacgtttagttatgcaactgacgta
cgaccctttaagctcggtgcttttaaaatcgcagccgaactagggaaacccatttgcccg
gttgctattgttggcgctagaaaaattttgcgcgcgaatcaattcttagtaaaaccagcg
aaattggaagtcattatttttaaacccttaatccctgagagtaaggaatgggaggaggtt
atgcggttacgcaaacaatcccgctttttaattgcgaaatacagcggtgagcacgttcta
gatttggtttcagcgggagtgctaagtgaatcagagtaa

DBGET integrated database retrieval system