KEGG   Clostridium botulinum E3: CLH_2152Help
Entry
CLH_2152          CDS       T00767                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cbt  Clostridium botulinum E3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLH_2152
Enzymes [BR:cbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CLH_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2302313..2303884)
Genome map
AA seq 523 aa AA seqDB search
MTIKFLIIVVFVIVGGIMYLNLEQDKANDVEKKEDKVYIEDKKETNKTMMQYFEWYYPND
GSLWNKVKERSKELSQKGITALWLPPAYKGVGGINDVGYGAYDLYDLGEFDQKGTIRTKY
GTKEEYLDAINEAHNNNIEVYADVVLNHKAGADESESVKAQLVDSNNRNNIIGEEKEIKS
FTVFNFKGRNEKYSSYKWNAKDFDGVDFDDLTKQNGIFKFVGKEWENDVDDENGNFDFLM
CADLDIDSRDVVEELKTWGNWYINECKLDGFRLDAIKHIKFDFFTEWLNDIRSKKGDNVF
GVGEYWSGDINKLKYYISKSQNVMSLFDVPLHYKFFEASNLEENFDMRTLTQNTLLEHDE
KISVTFVDNHDTEPGQALESWVKPWFKLLAYTFILTRQQGYPCIFYGDYYGIPEKGFEGF
KNQLDVILNVRKNYAYGDQCDYFDDKNIIGWTRQGDLVHDNSGVAVLISNGNDGSKKMCM
GSKNISTTFIDITGNIQEEILIDNEGNGIFKVNNKSYSIWIKK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaatttttaataatagtagtatttgtaatagtaggaggaataatgtattta
aatttagaacaagacaaagctaatgatgtagaaaaaaaagaagacaaagtttacatagaa
gataaaaaagagacaaacaaaactatgatgcaatattttgaatggtattatcctaatgat
ggttctctttggaacaaagtaaaagaacgttctaaggaattaagtcaaaaagggattact
gcattgtggcttccacctgcttataaaggggtaggtggtattaatgatgttggatatggt
gcttatgatttgtatgatttaggagaatttgatcaaaaaggaaccataaggactaaatat
ggtaccaaagaagaatatttagatgctataaatgaagcacataataataatatagaagta
tatgcagatgttgtattaaatcataaagcaggtgcggatgaaagcgaatctgtaaaagca
caattagtagatagtaataacagaaataatattataggagaagaaaaagaaataaagtca
tttactgtatttaattttaaaggaagaaatgagaagtattcatcttataagtggaatgca
aaagattttgatggggtagatttcgatgatttaacaaaacaaaatggaatatttaaattt
gtaggtaaagaatgggaaaatgatgtagatgatgaaaatgggaattttgattttttaatg
tgtgcagatttagatatagatagtagagatgttgtagaagaacttaaaacgtggggaaat
tggtatataaatgaatgcaaattagatggatttagattagatgcaataaaacatataaaa
tttgatttttttacagaatggttaaatgatattagaagtaaaaaaggtgacaatgtattt
ggtgttggtgaatattggtctggagatataaataaattaaaatattatattagtaaatca
caaaatgttatgtcgttatttgatgtaccacttcattataaattttttgaagcaagtaat
ttagaagaaaactttgatatgagaacattaactcaaaatactttattagaacacgatgaa
aaaatttcagtaacttttgttgataatcatgacactgaaccaggtcaggctcttgaatct
tgggttaagccatggtttaaattattagcatatacatttatattaacaaggcaacaagga
tatccatgtatattttacggagattattatgggattcctgaaaagggatttgagggtttt
aagaatcagttggatgtgattttaaatgtaagaaaaaattatgcttacggtgatcaatgt
gattattttgatgacaaaaatataattgggtggactagacaaggtgatttagtgcacgat
aattcaggtgttgcggtattaataagtaatggtaatgatggcagtaaaaagatgtgtatg
gggagcaaaaatataagtactacttttatagatataacaggaaatatacaagaagaaata
ttaatagacaatgagggcaatggaatttttaaagtaaataataaatcatattcaatatgg
ataaaaaaataa

DBGET integrated database retrieval system