KEGG   Coxiella burnetii RSA 493: CBU_1928Help
Entry
CBU_1928          CDS       T00124                                 

Definition
(RefSeq) acyl-CoA synthetase
Organism
cbu  Coxiella burnetii RSA 493
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1845001..1847811
Genome map
AA seq 936 aa AA seqDB search
MDKSLTEIESQVISLTHQFLLESGAERAARAVSLDARLEHDLGIGSLEKAELFSRIEKSL
GVELPESLLVKAKQLNDVVKAVKMAEPTLLKVKREVIAPLKSTRTDPSKVETLVELLNLY
AQNEPDRPHIYFQNEFGEETIIRYGELYTRAKEFAQGLVGKGLKPSETVAIMLPTSADFF
YSFLGTLMAGGIPVPIYPPFRADQIEEYAKREAFILHNAGVRFLITFKRAAALSKLLQSF
VPSLLEVTTVKALTDISADLPTLDIEATDPVLIQYTSGSTGNPKGVLLNHANLLANISAY
GKTLNMQSTDAFVSWLPLYHDMGLIGAWMGSFYHGLPLTLLSPFTFLSRPEKWLWAIHYH
RGTISPGPNFAYDLCVKKIEDSDLEGLDLSSWRVALNGSEMIHPDTLRNFEKRFRKYGFK
KEAIFPAYGLAECALGLTFPPLNRGPNIDRIERLPYEKNNTAVPLTTRDKKYYEFVSCGS
VLEGHEIRIVDDNDNRVAERTIGNIQFKGPSAMQGYYRNSEATMAIYHNGWWATGDLGYL
AEGELFITGRKKDLIIKAGRNYHPTEIEAMASLAEGVRKSCVAAFGVADEKRGTEKLIIV
AETKEDKKIQPEIKKEIVDKVISQIGIPPDEILLVPPHTLPKTSSGKLRRSSCKQDYLAG
KLSRPGRSAFWQTIKLFIKSRAKKIEKWLINLIKVVFSFYVLILLFFTLLPVWLLVIILP
RKKAAAAFRFWAGSIFRLIFSPISIKGKENISGQPMIYVANHGSFIDSVILAGVLPADTN
FIGKKELLKTPVIKSFVKQLDLVTVDRMDFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSY
ATDVRPFKLGAFKIAAELGKPICPVAIVGARKILRANQFLVKPAKLEVIIFKPLIPESKE
WEEVMRLRKQSRFLIAKYSGEHVLDLVSAGVLSESE
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatcattaacggaaatcgaatcgcaagttatttccctcacccatcaatttctg
ttggagtctggcgctgaacgcgccgcccgcgccgtttctctcgatgcacggttagagcac
gatttggggataggcagtctagaaaaagcagaattatttagccgcattgaaaaatcatta
ggtgtcgaattacccgaatctcttctcgtaaaagccaagcaattaaacgatgttgttaaa
gccgtaaaaatggctgaacccactttgctcaaagtgaaaagggaagtcatcgcaccgctt
aaaagcactcgcaccgatccttctaaagtcgaaacgttagtcgaactcctcaacctctat
gctcaaaatgagcctgatcgtccgcacatttattttcaaaatgaatttggcgaagaaacc
attattcgttacggcgaactttatacgagagcaaaagaattcgcccagggtttagttgga
aaagggttaaaacccagtgaaaccgttgccattatgcttcccacgtcggccgattttttt
tattcatttttaggcacattgatggccggcggaatccctgttcctatttatccccccttt
cgtgctgatcaaattgaagaatatgccaagcgcgaagcctttatattgcataacgccggc
gttcgattcttaatcacgttcaaacgcgccgctgcactaagtaaattacttcaatcgttt
gttcctagcctattagaagtgactaccgtcaaagcattaacggatatatcagcggattta
cccacattagatattgaagctacagatcctgtgttaatccaatatacctctgggagcacg
gggaatccaaaaggggtattgctgaatcatgctaatttattagcgaatataagcgcctat
ggaaaaacgctcaacatgcagtcaacggatgcgttcgtcagttggcttccgctttaccat
gatatgggtttgatcggcgcttggatgggaagcttttaccatgggttaccgttaacttta
ctttctcctttcacttttttatcccgtcctgaaaaatggttatgggcgattcattatcac
cgagggactatatctcccggtcctaatttcgcttacgacctgtgcgtaaaaaaaattgaa
gatagcgatcttgagggcttggatttaagttcttggcgagtagctctaaatggatcggaa
atgattcatcctgacaccttgcgtaattttgaaaaacgattcaggaaatatggatttaaa
aaagaagcgatttttcccgcttacggccttgcagaatgtgctttggggctcacttttcct
cctttaaatcgggggccgaatatcgatcgaatcgagcgattgccttatgaaaaaaacaat
accgccgtaccgttaaccacgcgcgataagaaatattatgaattcgtttcctgcggcagt
gttttagaaggacacgaaatccgtattgtggacgataacgataatcgggttgctgaacgt
acgattggaaatatccagtttaaaggcccctccgccatgcaaggttattaccgtaactca
gaagcaacgatggcgatttatcataatggttggtgggcgacgggagaccttggatattta
gccgaaggagagctttttattactggtcggaagaaagatttaattattaaggccggtcgt
aattatcatcccacagaaatcgaagcaatggctagcctcgctgagggagttcgaaaaagt
tgtgtggctgcttttggggtagctgatgaaaaaagagggacggaaaaattaataatagtc
gccgaaacgaaagaagataaaaaaattcaacctgaaataaaaaaagaaatagtagataaa
gtgatttcacaaatcggcatcccgcctgacgaaattttattagtgcctccgcacaccttg
ccgaaaacatccagtggaaaattgcgtcgttcgagttgtaagcaagattatttggccgga
aaattaagtcgaccaggccggtctgctttttggcaaacgataaaattatttattaaaagt
cgtgcgaaaaaaatagaaaaatggttaattaatttgattaaagtggtatttagtttttat
gttctcattttattgtttttcaccttattacctgtttggttgttagtcattattctgcct
cgaaaaaaagcagccgccgcttttcggttttgggcgggttcaatttttcggctcatattt
tctcccatttctattaaaggaaaagaaaatattagcggacaaccgatgatttatgtcgct
aatcatggcagttttatagatagcgtgatacttgctggtgtattgccggccgacaccaat
tttatcggtaaaaaagaattgttaaaaacacccgtcataaaaagcttcgtcaagcaactt
gacctcgtcacggttgatcgcatggatttttcaaaaagccattctgatgtgaaacgaatt
gagcagacattggaacaaggccgttccgtccttatttttcctgaagggacgtttagttat
gcaactgacgtacgaccctttaagctcggtgcttttaaaatcgcagccgaactagggaaa
cccatttgcccggttgctattgttggcgctagaaaaattttgcgcgcgaatcaattctta
gtaaaaccagcgaaattggaagtcattatttttaaacccttaatccctgagagtaaggaa
tgggaggaggttatgcggttacgcaaacaatcccgctttttaattgcgaaatacagcggt
gagcacgttctagatttggtttcagcgggagtgctaagtgaatcagagtaa

DBGET integrated database retrieval system