KEGG   Cupriavidus basilensis: RR42_m3131Help
Entry
RR42_m3131        CDS       T03642                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
cbw  Cupriavidus basilensis
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbw00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    RR42_m3131
Enzymes [BR:cbw01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     RR42_m3131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
main:3326342..3327598
Genome map
AA seq 418 aa AA seqDB search
MTAMTREQCLALDQEDPLRRLRDQFALPQGVIYLDGNSLGARPRSAAARAAEVVSEEWGT
GLIRSWNTAGWFELPQRLGNMLAPLIGAGEDEVVVTDTTSSNLFKVLAAALRVQQTRDPK
RKVIVSEASNFPTDLYIAQGLADLLQQGYSLRLVNAPEEIDAAVDADTAVLMLTHVNYKT
GEMLDMASVTEMAHARGALTVWDLAHSAGAVPVALKASGADYAVGCTYKYLNGGPGSPAF
LWVAPSLRDAFWQPLSGWWGHAAPFAMEPGYRPREGVARFLCGTQPIASLAMVECGLDIY
AQTDMAVLRAKSLMLTDLFIALVETRCAAHPLELVTPRAHARRGSHVSFAHPDGFAVVQA
LIERGVIGDYREPRIARFGFTPLYTSFTEVWDAVEILRDVLDSGTYKAERHQTRGLVT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaatgactcgcgagcaatgcctcgccctcgaccaagaagatccgctgcgccgc
ctgcgcgaccagttcgcgctcccgcaaggcgtgatctacctcgatggcaactcgctgggc
gcgcgcccgcgcagcgccgcggcacgcgccgccgaagtggtgagcgaggaatggggtacg
ggcctgatccgcagctggaacacagccggctggttcgaactgccccagcgcctgggcaat
atgctggcaccgctgatcggcgccggcgaggacgaagtcgtggtgaccgacaccacctcc
tccaacctgttcaaggtgctggcggccgcgctgcgcgtgcagcagacccgcgacccgaag
cgcaaggtgatcgtatcggaagccagcaacttccccaccgacctctacatcgcgcagggg
ctggccgacctgctgcagcaaggctattcgctgcgcctggtgaatgcgcccgaggagatc
gatgcggcggtggacgccgacaccgccgtgctgatgctgacccatgtcaactacaagacc
ggcgaaatgctcgacatggccagcgtgaccgagatggcgcatgcccgcggcgcgctcacg
gtgtgggacctggcccactcggccggcgccgtgcccgtggcgctcaaggcttccggtgcg
gactacgcggtcggctgcacttacaagtacctcaacggtggccccggctcgcccgccttc
ctgtgggtcgcgccgtcgctgcgcgatgctttctggcaaccgctgtccggctggtggggc
catgccgcgccgttcgcgatggaacccggctaccgcccgcgcgaaggcgtagcgcgcttc
ctgtgcggcacccagcccattgcctcgctggccatggtcgaatgcgggctcgatatctat
gcccagaccgacatggcagtgctgcgcgccaagtcgctgatgctgaccgacctctttatc
gcgctggtggaaacacgctgcgccgcgcacccgctcgaactggtgaccccgcgcgcccat
gcgcgccgcggcagccatgtgagctttgcccatccggacggctttgccgtggtgcaggcc
ctgatcgagcgcggcgtgatcggcgactaccgcgagccacgcatcgcgcgctttggcttc
acgccgctgtacaccagcttcaccgaagtctgggacgcagtggaaatcctgcgcgacgtg
ctcgacagcggcacttacaaggcagagcgtcaccagacgcgcggcctggtgacctga

DBGET integrated database retrieval system