KEGG   Clostridium beijerinckii ATCC 35702: Cbs_4852Help
Entry
Cbs_4852          CDS       T03415                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz00010  Glycolysis / Gluconeogenesis
cbz00030  Pentose phosphate pathway
cbz00051  Fructose and mannose metabolism
cbz00052  Galactose metabolism
cbz00680  Methane metabolism
cbz01100  Metabolic pathways
cbz01110  Biosynthesis of secondary metabolites
cbz01120  Microbial metabolism in diverse environments
cbz01130  Biosynthesis of antibiotics
cbz01200  Carbon metabolism
cbz01230  Biosynthesis of amino acids
cbz03018  RNA degradation
Module
cbz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbz_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbs_4852
   00030 Pentose phosphate pathway
    Cbs_4852
   00051 Fructose and mannose metabolism
    Cbs_4852
   00052 Galactose metabolism
    Cbs_4852
  Energy metabolism
   00680 Methane metabolism
    Cbs_4852
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cbs_4852
Enzymes [BR:cbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cbs_4852
Protein phosphatases and associated proteins [BR:cbz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cbs_4852
Messenger RNA biogenesis [BR:cbz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cbs_4852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AIU00540
LinkDB All DBs
Position
complement(5677573..5678529)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALHNGIEVMGVQRGYSGLINGELFSMDRNSVSDI
IQRGGTILRTARCPEFKNEEVRKKAAKILQAYGVEALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRDCGDLSLYA
GICGGAEAIIIPEMEFDKDALCRTILEGKNKGKMHNLIMLAEGIGGAFELAKYVEEVTGI
ETRATILGHIQRGGSPTATDRVLASRMGAKAIEVLLKGGTSRVIGIRDNKIIDQDIDEAL
DMESKFDKELYDIAQVLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtgttaacaagtggtggagatgcaccaggcatgaatgctgcaatt
agagcagtagtaagaactgcgcttcataacggaattgaagttatgggagtacaaagaggt
tatagtggacttattaatggagaattattcagcatggatagaaattcagtatctgatata
atccaaagaggtggaacaattttaagaactgctagatgtcctgaattcaagaatgaagaa
gtaagaaaaaaggctgcaaaaatattacaagcttatggtgttgaagctctagtagttata
ggtggagacggttcatttatgggtgcaaaattattatcaaagcttggaattaaaacaata
ggtttaccaggaacaattgataatgatttagcttacacagacttcactttagggtttgat
acagccttaaataccgttgtagatgctataaataaaattagagatacttcaacttcacat
gaaagagtttcaattgtagaagttatgggtagagactgcggagatttatctttatatgca
ggtatctgcggaggcgcagaagcaattataattcctgaaatggaatttgataaagatgca
ctttgtagaactatcttagaaggtaaaaataaaggaaaaatgcataatctaataatgctt
gcagaaggaattggaggagcatttgaacttgcaaagtacgttgaagaagtaactggaatt
gaaacaagagcaacaatcttaggtcatattcaaagaggaggaagtcctactgctacagat
agagttttagcttcaagaatgggagcaaaggctatagaagtattattaaaaggtggaact
tcaagagtaataggaattagagataataaaataatagaccaagatatagatgaagctctt
gatatggaaagcaaatttgataaagaactttatgatattgctcaagtattatcataa

DBGET integrated database retrieval system