Cervus canadensis (wapiti): 122439899 Help Entry 122439899         CDS       T07554                                  Symbol CXCL14 Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04061   Viral protein interaction with cytokine and cytokine receptor ccad04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122439899 (CXCL14)    04061 Viral protein interaction with cytokine and cytokine receptor     122439899 (CXCL14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     122439899 (CXCL14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122439899 (CXCL14) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Chemokines    122439899 (CXCL14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 NinB DUF4863 Motif Other DBs NCBI-GeneID:  122439899 NCBI-ProteinID:  XP_043321394 LinkDB All DBs Position 4:61608684..61617155 Genome browser AA seq 99 aa AA seqDB search MRLLTAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT KSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaggctcctgaccgccgcgctgctcctgctgctcctggcgctgtgcgccgcgcgcgtg gacgggtccaaatgcaagtgctcccgaaagggacccaagatccgctacagcgacgtgaag aagctggaaatgaagccaaagtacccgcactgcgaggagaagatggttatcatcaccacc aagagcatgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaaatggtacaacgcctggaatgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system