Cyanistes caeruleus (blue tit): 111930717 Help Entry 111930717         CDS       T05602                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04010   MAPK signaling pathway ccae04012   ErbB signaling pathway ccae04068   FoxO signaling pathway ccae04137   Mitophagy - animal ccae04140   Autophagy - animal ccae04144   Endocytosis ccae04150   mTOR signaling pathway ccae04210   Apoptosis ccae04218   Cellular senescence ccae04370   VEGF signaling pathway ccae04371   Apelin signaling pathway ccae04510   Focal adhesion ccae04540   Gap junction ccae04625   C-type lectin receptor signaling pathway ccae04810   Regulation of actin cytoskeleton ccae04910   Insulin signaling pathway ccae04912   GnRH signaling pathway ccae04916   Melanogenesis ccae05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111930717 (HRAS)    04012 ErbB signaling pathway     111930717 (HRAS)    04370 VEGF signaling pathway     111930717 (HRAS)    04371 Apelin signaling pathway     111930717 (HRAS)    04068 FoxO signaling pathway     111930717 (HRAS)    04150 mTOR signaling pathway     111930717 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111930717 (HRAS)    04140 Autophagy - animal     111930717 (HRAS)    04137 Mitophagy - animal     111930717 (HRAS)   09143 Cell growth and death    04210 Apoptosis     111930717 (HRAS)    04218 Cellular senescence     111930717 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111930717 (HRAS)    04540 Gap junction     111930717 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111930717 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111930717 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     111930717 (HRAS)    04912 GnRH signaling pathway     111930717 (HRAS)    04916 Melanogenesis     111930717 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111930717 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111930717 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccae04147]     111930717 (HRAS)    04031 GTP-binding proteins [BR:ccae04031]     111930717 (HRAS) Membrane trafficking [BR:ccae04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     111930717 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     111930717 (HRAS) Exosome [BR:ccae04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    111930717 (HRAS)   Exosomal proteins of colorectal cancer cells    111930717 (HRAS) GTP-binding proteins [BR:ccae04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111930717 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  111930717 NCBI-ProteinID:  XP_023784639 LinkDB All DBs Position 5 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgacg atacagctcattcagaaccattttgttgatgagtatgaccccacaatagaggattcctac agaaagcaagtagtcatcgatggagagacctgtttgttagacatcttggacactgcaggg caggaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctgtgt gtctttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtggggaataaatgtgacctc cctgcacggacagtggagacccggcaagcacaggacctggcccggagttacgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaggatgccttctacaccttggtg cgggagatccggcagcataagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtggtatcgtga

DBGET integrated database retrieval system