Cyprinus carpio (common carp): 109068420 Help Entry 109068420         CDS       T05134                                  Name (RefSeq) ras-related protein Rab-3D-like   KO K07884   Ras-related protein Rab-3D Organism ccar  Cyprinus carpio (common carp) Brite KEGG Orthology (KO) [BR:ccar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109068420   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109068420    04031 GTP-binding proteins [BR:ccar04031]     109068420 Membrane trafficking [BR:ccar04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     109068420 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109068420 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Rab Family    Rab3/27 [OT]     109068420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Fin RsgA_GTPase Motif Other DBs NCBI-GeneID:  109068420 NCBI-ProteinID:  XP_018940777 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MGFLLIYDITNQDSFFAIQDWATQIKTYSWDNAQVILVGNKCDLEDDRLIPTEDSQRLAH ELGFQFFEASAKDNINVKQVFECLVDVICDKMNENMDGDGPVSNHKDSSPQDTSSEGHAG CAC NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgggcttcctgctaatctatgacatcacaaaccaggactcgttcttcgccattcaggac tgggccactcagataaagacatactcatgggacaacgcacaggtgattctggtgggcaac aagtgtgacctggaagatgacagactcattccgacagaggacagtcagagattggctcat gaactcggtttccagttttttgaggccagcgccaaagacaacatcaacgtcaagcaggtt tttgagtgtctggtggacgtgatatgtgacaagatgaatgaaaatatggacggagatggt ccagtgtccaaccacaaagactccagtccgcaggacacgtcctctgagggacacgccggc tgtgcctgctaa

DBGET integrated database retrieval system