KEGG   Clostridium cellulolyticum: Ccel_1239Help
Entry
Ccel_1239         CDS       T00835                                 

Definition
(GenBank) Carbohydrate binding family 6
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cce  Clostridium cellulolyticum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ccel_1239
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ccel_1239
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ccel_1239
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Ccel_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1526092..1529139
Genome map
AA seq 1015 aa AA seqDB search
MLRKKILCIFLVTVLMLTILPIPQQTVMADTGVLKELKGTDIYNGLRGLNFNEGWKFNKG
DVSNGQSTGYNDSGWSGVTLPHDWSIYNTFNKSSAAGAGGGYLDGGIGWYRKTFTVPSDY
TGKKVFIEFDGAYMNSQVWINGTLLGTRPYGYSSFEYDLTPYLNIGGSNVIAVRLNNNQP
TSRWYSGSGIYRNVWLTVLDPVHVTYCGMFVTTPTVSSSSATANVSTKVLNQGSTAKSVS
LKTTITDAEGNVVATNTSSVASIAGSGSNTFSQNLTVSNPHLWSPASPYLYAVQTQVIVD
GNVTDTYSSTLGIRYFSFSSTSGFSLNGVNMKINGVCLHHDLGSLGAAVNYRAIERELQI
MKDMGCNAIRTSHNPPDPQMLEICDRLGLMVMDEAFDCWETGKNSNDYHLYFNNWAQTDL
QAMVTRDRNHPSIIMYSIGNEIPSPSVATATKLKNWVKDVDNTRPVTLGTFAVSMGDATP
QAVASVLDLVGYNYFPYMYDGGHNNHPEWKMFGSETSSAVRSRGVYKTPTNKNILTDSDN
QCSSYDNSVVSWGNSAESSYNEINKRNYMAGEFIWTGFDYIGEPTPYEWPAKSSYFGIVD
TCGFPKDIYYFYQSKWSTKPMVHILPHWNWSTGTNVEVWAYSNCDTVELFLNGKSLGSKS
VGTAGHLSWSVPWSSGTLRAKGTKGGTVVYDEVVTAGTPSKVLLKPDRTSVKADGKDLIY
IETDIADGNNVTVPTADNTVNFSISGPGVIVGVDNGNPISTEAYKGSSRKAFNGKCLVIV
QPTKVNGTIVVTASSNGLSSGSVSIASTGGAEAPIVSAYKKIEAENYDNQSGIQTEACSE
GGQDVGFIENGDYTVYNNVDFGSGAESFTARAASATSGGNIEIRLDSPNGTLIGTCPVAG
TGDWQTYADVNCSVSEVSGKHDLYLKFTGDSGYLFNINWFTFTARNSAKLGDLNSDDQID
AMDFQLMKKYLLGLGEIKDTKLADLDASGTIDVLDLMLLKQYLLGTITSFPGQGT
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaaagaaaattttatgtatatttcttgtgactgtattaatgctaactatatta
ccaatacctcaacagacggtaatggctgatacaggggtacttaaggaacttaaaggaact
gacatctacaacggattaaggggactgaattttaacgagggttggaaattcaataagggg
gatgtaagcaacggccagagtaccgggtataatgacagcggctggtcaggtgttacactg
ccacatgactggagtatttataacacttttaataaatcctcagcagcgggtgcaggagga
ggttatctggatggaggaatcggatggtacaggaaaacctttaccgtaccttcggattat
acaggaaagaaggtattcattgaattcgacggagcgtacatgaacagccaggtatggatt
aacggtactttgctgggaacccgtccatatggctattcatcctttgaatatgatttaact
ccatacctcaatataggtggaagtaatgttattgcagtaaggctcaacaataaccaaccc
actagccgctggtattcaggaagcggtatttatcggaatgtatggctgacagtattagat
cctgtgcatgtgacatactgcggaatgtttgtaacaacacccacggtcagcagcagttcg
gccaccgcaaacgtcagcacaaaggtattgaatcagggaagtactgcaaaatcggtatca
ttaaaaactacaattaccgatgcggagggtaatgtcgtagccacaaatacttcttcagtg
gctagtatagctggcagtggtagcaataccttcagtcagaatctgacagtatcaaacccg
catttatggtctcccgcttcaccatacctatatgctgttcaaacccaggttattgtggac
ggaaatgtaacagatacatatagttctacattgggaatcagatatttcagctttagctcc
acatcaggcttttcacttaatggtgtaaatatgaagataaatggagtgtgtctgcatcat
gatttgggttctcttggtgcggctgttaactatcgtgcaattgaaagagaacttcagatt
atgaaggatatgggatgtaatgcaattcgtacttcacataacccgccagacccgcaaatg
ctggaaatatgtgacagattaggtttgatggttatggatgaagcatttgactgctgggaa
acaggaaaaaattctaatgactaccatctgtactttaacaattgggcacagaccgatctt
caagcaatggttacaagggatcgtaatcatccgtcaattatcatgtacagcataggcaat
gagattccttcaccaagtgtagctacagcgacaaagcttaagaattgggtaaaagatgtt
gataacacacgaccagtcacattgggaactttcgccgtaagcatgggtgatgcaactccg
caggcggtcgcaagtgttcttgatttagtgggctataactattttccatacatgtacgac
ggaggacataacaatcatccggagtggaagatgtttggaagtgaaacgagttcagcggtc
agaagccgcggggtttataaaacacccaccaataaaaacatcctgactgacagtgataac
cagtgttcctcttatgataacagtgtggtcagctggggcaacagtgctgaatcttcctat
aatgaaattaataaaagaaattacatggcgggtgaattcatatggacaggatttgactat
atcggtgaacctacaccttacgaatggccggcaaaaagttcgtattttggaatagtggat
acatgcgggttcccgaaagatatctactatttctatcaaagtaagtggagtactaaaccg
atggttcacatactcccacattggaactggtctacgggtactaatgtagaggtatgggca
tacagtaactgcgatactgtagaactattccttaatgggaagtcacttggctcgaaaagc
gttggaacagcaggacatctttcatggagtgttccatggtcttcagggacattgcgggca
aaaggtacaaagggcggcactgtggtatacgatgaagtcgtcacagcaggtactccttca
aaagtcctgttgaagcctgacagaacttctgttaaagcagacggtaaggatttgatatat
atcgaaacagatattgcagacggcaacaatgtgactgtccccacagctgacaatacagtg
aatttctccatatcaggtcccggtgtaattgtgggagttgataatggaaatccaataagt
acggaagcatataaaggcagcagtcgtaaggctttcaacggtaagtgtctggtaattgtc
cagcctaccaaagttaatggaacaattgtagtaacggcaagctccaacggactatcctct
ggaagtgtttccatcgcttcaacaggaggagcagaagcacccatcgtatctgcctataaa
aagattgaggccgaaaactacgataatcagtctggaatccagacagaagcctgttcggaa
ggcggacaggatgtaggatttattgaaaacggggactacactgtttacaacaatgtggat
ttcggtagcggtgccgagagctttacggcaagagcagcaagtgctactagcggaggaaat
attgagatcagacttgacagtcctaacgggactttaattggaacttgtccagttgcagga
acaggtgattggcagacttatgctgatgtaaattgcagtgtcagcgaggtaagcggaaaa
cacgacctgtatctaaaattcaccggggatagcggatatttatttaatattaactggttt
acatttactgcacggaattcagcaaaattgggagatttgaattccgatgaccaaatagac
gcgatggatttccagttgatgaaaaagtatctgctgggactgggagaaattaaagataca
aagctggccgatttggatgcaagtggtactattgatgttttagatctgatgctgctcaaa
cagtacctgctaggcactataacttcttttccggggcagggtacttaa

DBGET integrated database retrieval system