KEGG   Cellulosimicrobium cellulans: CBR64_08430Help
Entry
CBR64_08430       CDS       T04858                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cceu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBR64_08430
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBR64_08430
Enzymes [BR:cceu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CBR64_08430
Bacterial toxins [BR:cceu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CBR64_08430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1961550..1963922)
Genome map
AA seq 790 aa AA seqDB search
MSVPLAVPLDPSILPGYLPDVRHLTSSVQASSAASPRSTSYPPRRAPTGRNGMIGHLRRP
ARRALTLATALALGVSGAVVPVTTAAAHHTALAPDHDLAPATGGPGTFAEQQLATNGQGG
FPNYRIPALTVAPNGDVLASYDGRPTAADSPGPNSILQRRSTDAGVTWGPQEVVAAGKTT
APIEGYSDPSYVVDRETGTVFNFHVKSYDQGFGGSQPGVDPAARDVIHANVSASTDDGRT
WTHRTITADVTADLGWRSRFAASGQGIQLRYGEHAGRLVQQYTIINGSGQFQAVSVYSDD
HGATWQVGTPVGTGMDENKTVELSDGRVMLNSRDSARSGFRKVAYSTDGGVTYGAVTLDR
ELPDPTNNAAIVRAYPNAPQGSDEAKVLLFSNAASQSGRVNGTVRMSYDDGETWPVARVF
QPGGMAYSTLATLPDGTVGLLYEPDGGGGGIRFAKLDHDWLLAAPSSTPGDIEVTRASVT
STAPAGGYAVGDVVTYAFTVTNLSDAVTTVSPTGDLERFDPAQGAPNCRFRDLAARAAYT
CTSARHTVTQADLDVGFFAPTTTWTSTSGTTVTTVEHEGPGVYFGAPGNIAVQGAHANPQ
DAYAVGDVLRFTYTVRNLSTAATSVVPTGNLAGLDPANAAQNCRYRTLPAEGSYTCTFAH
HVVTRADLDRGSFTPDTTWTSTSGSSVTVVELDGPTVELGAASPALEVRATSRCLAGRAY
VAVTAQNTGDEAADITLTTPYGQRTVSGVQPGSSAYQSFAARAATVDAGAASAAVGDASL
DAGYAAATCA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaccccttgccgtaccccttgacccctccatccttccgggctaccttcctgac
gtcagacatctgacgtcatctgttcaagcatcctcggcagcgtcgccgcgttccacgtcg
tacccgccgcgccgagcaccgaccggaaggaacggcatgatcggacacctccgcagaccc
gcgcgccgcgcgctgaccctcgccaccgcgctcgcgctcggggtgagcggcgccgtcgtc
cccgtcacgacggcggcggcccaccacacggccctcgcaccggaccacgacctcgctccc
gcgaccggtggcccgggcacgttcgccgagcagcagctcgcgaccaacggccagggcggc
ttccccaactaccgcatcccggcgctcaccgtggcgcccaacggcgacgtcctcgcctcc
tacgacggccgccccaccgcggccgactcccccgggccgaactcgatcctccagcgccgc
tccaccgacgcaggtgtcacgtggggcccgcaggaggtcgtcgcggccgggaagaccacc
gcgccgatcgagggctactcggacccgagctacgtcgtggaccgcgagacggggaccgtc
ttcaactttcacgtgaagtcgtacgaccagggcttcggcggctcccagcccggcgtcgac
ccggccgcgcgcgacgtcatccatgcgaacgtctccgcctcgacggacgacgggcgcacg
tggacgcaccgcaccatcaccgcggacgtcacggccgacctgggctggcgctcgcgcttc
gccgcctcgggtcagggcatccagctccgctacggcgagcacgcggggcgcctggtgcag
cagtacacgatcatcaacggctcggggcagttccaggccgtctccgtctactccgacgac
cacggcgcgacctggcaggtcgggacccctgtcggcaccggcatggacgagaacaagacc
gtggagctctcggacgggcgggtcatgctcaactcgcgcgactcggcgcgctcgggcttc
cgcaaggtggcctactcgaccgacggcggcgtcacgtacggcgccgtgaccctcgaccgc
gagctgcccgacccgacgaacaacgccgcgatcgtgcgggcgtacccgaacgcgccgcag
ggctccgacgaggccaaggtgctcctcttctcgaacgcggcgtcgcagtccggccgcgtc
aacggcaccgtccggatgagctacgacgacggcgagacgtggcccgtcgcgcgcgtcttc
cagccgggaggcatggcgtactcgacgctcgcgacgctccccgacggcacggtcggcctg
ctctacgagcccgacggcgggggcggcggcatccggttcgccaagctcgaccacgactgg
ctcctcgccgcgccgagcagcacgcccggcgacatcgaggtcacgcgcgcgagcgtgacg
agcaccgcccccgcgggcgggtacgccgtcggcgacgtcgtcacgtacgcgttcaccgtc
acgaacctgtccgacgccgtcacgaccgtctccccgaccggggacctcgagcggttcgac
cccgcccagggcgcgccgaactgccgcttccgcgacctcgcggcgcgcgcggcctacacg
tgcacgtccgcgcggcacacggtcacgcaggccgacctcgacgtcggcttcttcgccccg
accacgacgtggacgtcgacgtcgggtacgaccgtgacgacggtcgagcacgaggggccg
ggcgtctacttcggggcgcccgggaacatcgcggtgcagggcgcgcacgcgaacccgcag
gacgcgtacgccgtcggcgacgtcctgcggttcacctacacggtgcgcaacctgtccacg
gcggcgacctccgtggtcccgaccgggaacctcgccgggctcgaccccgcgaacgcggcc
cagaactgccgctaccgcaccctgccggcggaagggtcgtacacgtgcacgttcgcgcac
cacgtggtgacccgggccgacctcgaccgcgggtcgttcacgccggacacgacctggacc
tccacgtcggggtcgagcgtgaccgtcgtcgagctcgacggtccgacggtcgagctcggt
gccgcgtcccccgcgctcgaggtccgcgcgacgtcccgctgcctcgcggggcgggcctac
gtcgccgtcacggcgcagaacaccggcgacgaggccgccgacatcacgctgaccacgccc
tacgggcagcgcacggtcagcggcgtgcagccggggagctccgcgtaccagtcgttcgcc
gcgcgcgcggcgacggtcgacgccggggccgcgagcgccgcggtcggggacgcctcgctg
gacgcgggctacgcggcggcgacctgcgcctga

DBGET integrated database retrieval system