KEGG   Coprinopsis cinerea: CC1G_00844Help
Entry
CC1G_00844        CDS       T01275                                 

Definition
(RefSeq) heme peroxidase
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase GAGE
Motif
Other DBs
NCBI-GeneID: 6007766
NCBI-ProteinID: XP_001831297
UniProt: A8N8W9
LinkDB All DBs
Position
7
AA seq 1066 aa AA seqDB search
MSSSKVKRMSTLFRKKEKEPSTSNGVVTNGAEKKDEAASPTSPTSPLSPSQEAEGMKTMR
NFRESVKKGSPFDFSTSSIAAVLDLIRNKESIDDRKLFLEHALTFISRLEEGPLARTLKN
KIIQLLYNDLTHPASTSVSNQFAWRTADGSCNNVDIPDMGKAGTPYSRSVQQTVPLPKNQ
MPDAGLLFDTLLRREKFVPHPGGLSSLMFAFATLVIHTVFRTSHRDWTINETSSYVDLAP
LYGNNEDDQNRIRIRDGRGHLYPDVFAEDRLLLLPPAVCALLVLFSRNHNYIATKLLEVN
ERGTFVDPSTLSMDDPKQKAKLMAQDEELFQTARLVNCGWFAMVVFSDYFSCILGLVRDG
NSWSLTPFDEIRMEDHTLFERGKGNSCSVEFNCLYRWHTTTSREDEKWTEGVFSQLFPGK
PFEEVTIDDFKTTAHKLLTNRPPTTEWTFGGLKRQPDGRFRDEDLARIIQDATECEAAAF
GARGTPAVMRLNEIMGIEQSRRWGVCSLNEFRKFLGLKPYETFLEWNSDPDVARTAELLY
GDINKLELYVGLQAEEAKPLVDGAGLCPGYTCSRAILSDAIALTRGDRFFTHDFTPFNLT
AWGYQDCQRDPNAWGFGSTMARLFLRTLPEDFDEKSVYTFFPLMTPQSMKVHLTKLNQLD
NYDLARPKRNPCPTIIRDYPSVVAILNEPLGFRSPYSQKTRKIINGPIKGFYPAEGPKEQ
DVVRKALSGSPEVVGKVGTYFYEQIKKTIDENSYTFVNGKKRGIDVVKKVINTVPTAWLG
DLGGLHVKTSKDSAGNYTVDELFQQLSEIYSFIFLNVDPAKVMVLQEKVRKYLKVIIPDI
KDNFTGSFSLTGLFNTVFKYKKPVHHEIISRLTENETLKNHDVLSNVILALVVVGNAEIT
LASTNILDYYLGSDKAADIGKLAAAGDVAGLKPYIYEALRAVPPFAGVYRVSTREQIFAG
RKFAESERVFLDITAANNQSREESTKEILRAEGAFEYLGEELTVEILAQIIRAIFERPGL
TRAPGHSGQMSRFKTDNRPECHHTYLHHGERVTEWPYTLSVLYDAA
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaagcaaggtcaagcgtatgtccactctattccgcaagaaggagaaggagccc
tccaccagcaacggtgttgtcactaatggtgctgagaagaaagacgaggccgcctcgccg
acctccccaacttctccattgtcaccttcgcaggaggccgagggtatgaagacgatgagg
aacttccgcgagagcgtgaagaaggggagcccatttgacttcagcacctcgagtatcgct
gctgtcctggacctcatcaggaacaaggagtcgatcgacgacaggaaactcttccttgaa
catgctcttaccttcatttctcgcctggaagaaggccctctggctcgcaccttgaagaac
aagatcatccagctgctttacaacgaccttacgcatcctgcttccaccagtgttagtaac
cagtttgcatggagaaccgccgatggttcctgcaataatgtcgatatccctgacatggga
aaggctggaactccttattctcgttctgtccagcaaaccgtaccccttccgaagaaccaa
atgcccgatgcagggcttctcttcgacaccctcttacgaagagagaagttcgtcccacac
ccaggtggtctctcttctttgatgtttgcatttgccactttggtcatccataccgtcttc
cggacttcacaccgcgattggacaatcaacgagacctcctcctacgttgacctggcgccg
ctctacggcaacaacgaggacgatcaaaaccgcattaggatccgggatggccgaggtcac
ctctacccggatgtctttgctgaagaccgtctcttgttgcttccaccagctgtttgcgcg
ctcctggttctcttcagccggaatcacaactacatcgccactaagcttttggaggtcaat
gagcgaggaaccttcgtcgatcccagcaccttgtcaatggacgatcctaagcaaaaggct
aagttgatggctcaagatgaagagttgttccagacagcgcgtctcgtgaactgcggctgg
ttcgcaatggttgtcttctccgactacttctcttgcattctgggactggtccgagatggc
aatagttggagcttgactcctttcgatgaaatccgtatggaagatcacaccttgttcgaa
cgtggcaagggcaactcctgcagtgtcgagttcaactgtctctaccgatggcacaccacg
accagcagggaggacgagaagtggaccgaaggagtgttcagtcagctcttccctggcaag
cccttcgaagaggtcacgatcgacgacttcaagacgactgcccacaagttgctcacgaac
aggccacctaccaccgaatggaccttcggaggattgaagcgccagccagacggaagattc
agggacgaggatttggccaggattatccaagacgcaactgaatgcgaggcggctgcattt
ggtgctcgcggaaccccagcagtcatgaggctcaatgagatcatgggtattgaacagagt
aggcgatggggtgtatgctcgctcaacgagttcaggaagttcttgggcttgaagccttac
gagaccttcctcgaatggaactctgatcctgacgtcgctcgaactgccgaacttctctat
ggagacatcaacaagctcgagctctacgtgggcttgcaagctgaggaggccaagcctctt
gttgacggtgcaggtctctgccctggctacacttgcagtcgtgcaatcctcagcgacgcc
attgctttgactcgtggagaccgattcttcactcacgacttcacccccttcaacctcacc
gcctggggctaccaagattgccagcgcgatcccaatgcctggggtttcggtagcaccatg
gccaggctgttcttgcgaactctccctgaagactttgacgagaagagtgtctacactttc
ttcccgttgatgactccccagtccatgaaggtgcatctcaccaagctcaaccaattggac
aactacgatttggctcgacccaaacgcaacccttgtcccacaatcatcagggactatccc
tccgtcgttgcgatcctcaacgagccccttgggttcaggagcccctacagccaaaagaca
aggaagatcatcaacggccctatcaaaggattctatcccgcagaaggcccgaaagagcag
gacgtggttcgcaaggctctcagcggatctcccgaggtcgtcggcaaagtcggtacctac
ttctacgagcagatcaagaagaccatcgacgagaactcgtatacctttgtcaacggcaag
aagcgcggtatcgacgtggtcaagaaagtcatcaacacggtgcccaccgcctggcttggg
gacttgggtggtctccatgtgaagaccagcaaagactcggccggcaactacaccgtcgat
gagctcttccaacaactctccgagatctattccttcatcttcctcaacgtcgacccagcc
aaggtcatggtcctccaggagaaggttcgcaagtacctcaaggtaatcattcccgacatc
aaggacaacttcacgggtagcttctccctcactggtctcttcaacaccgtcttcaaatac
aagaagcccgtccaccacgagatcatcagtcgcctcacggagaacgaaactctcaagaac
cacgacgtcctctctaacgtcatcctcgcgctcgtcgttgtcggtaatgccgaaatcacc
ctcgcgtcgaccaacatcctcgactattatcttggaagtgacaaggctgccgatattggg
aaactcgctgctgctggggacgttgcgggcttgaagccttacatctatgaggccttgcgg
gctgtccctcctttcgctggtgtctaccgcgtctcgactcgcgaacagatctttgctggt
cgcaagttcgccgagagcgagcgtgtcttcttggacattaccgctgcgaacaaccagagc
cgtgaagagtccacgaaggagatcctccgtgctgagggtgccttcgagtaccttggtgaa
gagttgaccgtcgaaatcctcgctcaaatcatccgcgccatcttcgaacgacccggcctc
actcgcgcacctggccactctgggcagatgtcccgcttcaagaccgacaaccgacctgaa
tgccaccacacttacctccaccacggcgaacgggttactgaatggccatatactctttcc
gtattgtacgatgctgcctaa

DBGET integrated database retrieval system