KEGG   Clostridium carboxidivorans: Ccar_01215Help
Entry
Ccar_01215        CDS       T03979                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cck  Clostridium carboxidivorans
Brite
Enzymes [BR:cck01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ccar_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(245368..246024)
Genome map
AA seq 218 aa AA seqDB search
MFKLEPMNFNFSTVKGITEDQLMQHYKLYSGYVKKLNELWNFPVDARKYGEGNSTYSNMR
SLKLGETYALDGITLHQLYFENICNSFKKPYGEILNLITRDFKSFENFKEYLTNVGLSMR
GWAILVIDPIDNKLHIIGSDAHDVGALWNCYPLLVMDVYEHAYFIDFQTDRKKYIQIFIE
NINWKIVNERLEKYYLIKSTLNNLRCFGNNSICPIWYI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaattagagcctatgaattttaatttttctactgtaaaaggtattaccgaagat
caattaatgcagcattataaattatattctggatacgtaaagaaattaaacgaactgtgg
aattttcctgtagatgctagaaaatacggtgaaggtaattcaacttatagcaatatgaga
agtcttaaattaggagaaacttatgctttagatggaattacccttcaccaattatatttc
gaaaatatatgtaatagttttaaaaaaccctatggtgaaatacttaatttaataacgaga
gattttaaaagctttgaaaatttcaaggagtatttaacaaatgtagggctctccatgaga
ggttgggctattttagtcatagatcctatagataataaactccatatcataggttctgat
gctcacgatgttggagccttgtggaactgttatcctctacttgtcatggatgtatatgaa
catgcttatttcatagattttcagacagatagaaaaaaatacattcaaatatttatagaa
aatataaattggaaaatagtaaatgaaagacttgaaaaatactatttaatcaaatctaca
ttgaacaatcttaggtgctttggcaataattctatatgccctatatggtacatttaa

DBGET integrated database retrieval system