KEGG   Clostridium clariflavum: Clocl_0994Help
Entry
Clocl_0994        CDS       T01661                                 

Definition
(GenBank) hypothetical protein
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
ccl  Clostridium clariflavum
Brite
Enzymes [BR:ccl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Clocl_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1155032..1155787)
Genome map
AA seq 251 aa AA seqDB search
MLTISGNVVDVDTVIPDIGNDEIKLKIINIMNKSSYNYRFSSAQELYFILDMRKNIINAS
KKLFRSRLRFKTFKNSECNEYYWRRTPEGGFLLKSNVQPSKAINDIYNNGWLYGTECATA
IVIVYYKAVLDTFGTELFNRIFNDIYLMDWQNLSGKLRVSTNRKPPDIFPGDCRYFKNPD
VDPLTPEWQGENAIDLGNNYYYGHGVGITSAENIIYALNNHRKPGSNVSAYLLESSTNPD
YRSLYKLYNNN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgctgactatatccggcaatgttgttgatgttgataccgtcatacccgacatcggcaat
gatgaaatcaaattgaagattataaacataatgaataaaagcagttataattacagattt
tcctcagcccaggaactatattttattcttgatatgaggaaaaatattataaacgcttcc
aagaagctgtttagaagtcgattacgtttcaaaacctttaaaaactcggaatgcaatgag
tattattggaggcgaaccccagaaggcggttttttattaaaaagcaatgtgcagccatcc
aaagccattaacgacatttataacaatggttggttatatggtactgaatgtgctactgca
attgtcatagtctattataaagctgtgttggatactttcggtaccgaactgttcaaccgc
atattcaatgatatctacctgatggattggcaaaatctcagtggaaaacttagagtgagt
accaaccgaaaaccaccggatatttttcctggcgattgcagatattttaaaaatcccgat
gtagatccgttaactcctgaatggcagggtgagaatgctattgatttgggaaataattat
tactatggccatggagtgggaataacttcagccgaaaacataatatatgcattaaacaat
cacagaaagcctggttcaaatgtatcggcttacttgctggagtcatctaccaatcccgac
tatagaagcttatataagctatataacaataattaa

DBGET integrated database retrieval system