KEGG   Campylobacter coli 15-537360: N149_0471Help
Entry
N149_0471         CDS       T02895                                 

Gene name
tuf
Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ccq  Campylobacter coli 15-537360
Brite
Translation factors [BR:ccq03012]
 Eukaryotic Type
  Elongation factors
   N149_0471 (tuf)
 Prokaryotic Type
   N149_0471 (tuf)
Mitochondrial biogenesis [BR:ccq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    N149_0471 (tuf)
Exosome [BR:ccq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   N149_0471 (tuf)
  Exosomal proteins of breast cancer cells
   N149_0471 (tuf)
  Exosomal proteins of colorectal cancer cells
   N149_0471 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGZ20937
LinkDB All DBs
Position
471309..472508
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRRGLAELKDYDNIDNAPEEKERG
ITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSSYDFPGDDTPIISGSALKALE
EAKAGQDGEWSAKIMDLMAAVDSYIPTPTRDTEKDFLMPIEDVFSISGRGTVVTGRIEKG
IVKVGDTIEIVGIKDTQTTTVTGVEMFRKEMDQGEAGDNVGVLLRGTKKEEVIRGMVLAK
PKSITPHTDFEAEVYILNKDEGGRHTPFFNNYRPQFYVRTTDVTGSIKLADGVEMVMPGE
NVRITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattttcacgtaataagccacatgtaaacattggtactattggtcac
gttgaccacggtaaaactactttgacagctgctatttctgctgttctttcaagaagaggt
ttggcagaacttaaagattatgataatattgataacgctcctgaagaaaaagaaagaggt
atcactattgcaacttctcatattgaatatgaaacagataatcgccactatgcacacgtt
gattgtccaggtcacgctgactatgttaaaaacatgatcactggtgctgctcaaatggac
ggtgctatccttgttgtttctgcagctgatggtcctatgccacaaactagagagcacatc
cttctatcgcgccaagtaggtgttccatatatcgttgtatttatgaataaagcagatatg
gttgatgatgctgaacttttagaattggttgaaatggaaattagagaattattaagctct
tatgatttcccaggtgatgacacacctattatttcaggttctgctttaaaagctcttgaa
gaagcaaaagctggacaagatggcgaatggtcagcgaaaattatggatcttatggctgct
gttgatagctatattccaactccaactcgtgacactgaaaaagatttcttaatgccaatt
gaagatgttttctcaatttcaggtcgtggtactgttgttacaggtagaattgaaaaaggt
attgtaaaagttggtgatactatagaaatcgttggtattaaagatactcaaacaacaact
gtaactggcgttgaaatgtttagaaaagaaatggatcaaggtgaagcaggggataatgtt
ggtgttcttcttcgtggtacaaaaaaagaagaagttatccgcggtatggttcttgctaaa
ccaaaatcaattactccacatactgatttcgaagctgaagtttatatcctaaataaagat
gagggtggtagacatactccattctttaataactatagaccgcaattctatgtaagaaca
acagatgtaacaggttctattaaattagctgatggcgttgaaatggttatgcctggtgaa
aatgtaagaattactgtaagcttgattgcaccagtagcgcttgaagaaggtactcgtttt
gctatccgtgaaggtggtaaaactgttggttcaggtgttgtttctaaaattattaagtaa

DBGET integrated database retrieval system