KEGG   Chondromyces crocatus: CMC5_061690Help
Entry
CMC5_061690       CDS       T04010                                 

Gene name
prpE
Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ccro  Chondromyces crocatus
Brite
Enzymes [BR:ccro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     CMC5_061690 (prpE)
Lipid biosynthesis proteins [BR:ccro01004]
 Acyl-CoA synthetase
  Unknown
   CMC5_061690 (prpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8410280..8412037
Genome map
AA seq 585 aa AA seqDB search
MRTLIEVLRDNAVHTDRSVTFVRSNGEELSVSYPDLWLTARKRAHALRSLGLARGDRVAL
ILPDPDEFVLTFLAALTAGIVAVPMYPPQTLAKLEAYGDTVRHVLAASGARAVVTTEALR
GMLEEHLLAGGGVKTHGGVRVVLEREIHEADGFDPDADWSVELDETAFLQFTSGSTSSPK
GVMVTFRNLAVNSHAIMFDGLRSTPEDRGVSWLPLYHDMGLIGFVIAPLYALVQVMFLPT
TAFIRRPSIWLDAIHRFRGTITFAPNFAYALATRAVTETQAAGWDLSCMRALGCGAEPIQ
AEVLRGFLTRFAKNGLRPESILPSYGMAEATLAITFSDIDATLTTDRVDLMAMRAGMAKP
AADGAAAALELVACGRSFPGHEISVVAPDGTHLEDRQVGEVWLRGPSVTVGYFNEPASTE
DTFGGGWLRTGDLGYLADGQLYICGRAKDLIILGGKNYYPQDVERIVSRVDGIRDGQCVA
FSRLDASGGEQAVVVAECRKSTPELSQAVMRAVRAEVGVQLAEVILIKRGTLAKTSSGKV
RRREMKRRLETGELELAVAEDKGGVAPPPVPSRSGVFPPLLSGAS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctcattgaggtcctccgagacaacgcggtgcacacggaccgctccgtcacc
ttcgtccggtcgaacggtgaggagctgtcggtcagctaccccgatctctggctcaccgct
cgaaagcgcgctcatgcgctgcggtcgctcgggctcgcgcgcggcgatcgggtcgctctg
atcctgcctgatccggacgagttcgtcctgacgttcctggcagcactcaccgcaggcatc
gtggcggtcccgatgtatccgccgcagaccctcgccaaactcgaggcctacggcgacacg
gtccggcacgtcctcgccgcgtcgggcgcgcgcgccgtcgtgacgaccgaggcgctccgc
gggatgctggaggagcacctcctggcgggtggcggagtgaagacgcacggcggggtccgg
gtggtcctggagcgcgagatccacgaggcggacgggttcgatcccgacgcagactggtcc
gtcgagctcgacgagacggcattcctccagttcacctcgggcagcacgtccagccccaag
ggcgtgatggtgaccttccgcaacctggcggtgaacagtcacgccatcatgttcgacggg
ctccgctcgacgcccgaggatcgcggggtgagctggctgccgctgtaccacgacatgggc
ctgatcgggttcgtcatcgcgccgctgtacgcgctggtgcaggtgatgttcctgccgacg
acggcgttcatccgcaggccttccatctggctggacgcgattcatcggttccgcgggacg
atcacgttcgctccgaacttcgcctacgccctggcgacgcgggccgtcaccgagacgcag
gccgctggctgggatctgtcgtgcatgcgggcactcggctgtggcgccgagccgatccag
gccgaggtgcttcgcgggttcctgacgcgcttcgccaagaacgggctccggccggagagc
atcctgccgtcgtacgggatggcggaggcgacactggccatcaccttcagcgacatcgac
gcgacgctgaccaccgatcgggtcgatctgatggccatgcgcgcagggatggccaagccg
gcggccgatggcgccgcggccgccctcgagctggtcgcctgtgggcgcagcttcccgggg
cacgagatctccgtcgtcgcgcccgatgggacgcacctcgaggaccggcaagtgggtgag
gtgtggctgcgcgggccgagcgtgacggtcggttacttcaacgagccggcgtcgaccgag
gacaccttcggcggcggctggttgaggacgggcgatctcggctacctggccgacgggcag
ctctacatttgcgggcgggccaaggatctcatcatcctcggcggcaagaactactacccg
caagacgtggagcgcatcgtgtcgcgcgtcgacgggatccgcgatggacagtgcgtcgcg
ttctcgcggctcgatgcgagcggtggggagcaagcggtggtcgtcgcggagtgccggaag
agcacgccggaactgtcacaagcggtgatgcgcgcggttcgtgctgaagtcggtgttcaa
ctcgccgaggtgatactgatcaagcgcggcacgctcgcaaagacgtcgagcggcaaggtg
aggcgccgcgaaatgaagcgtcgactggagaccggggagctggaactcgcagtcgcagag
gacaaaggtggcgttgcgccgccgcccgttccttcccggagcggggtgttccccccgctc
ctgagtggagcgagctga

DBGET integrated database retrieval system