KEGG   Cupriavidus sp. USMAHM13: BKK81_33770Help
Entry
BKK81_33770       CDS       T04762                                 

Definition
(GenBank) hypothetical protein
Organism
ccup  Cupriavidus sp. USMAHM13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
unnamed1:complement(215512..218331)
Genome map
AA seq 939 aa AA seqDB search
MSETNNSIPRATVDAQELLAIVRRLAAELRPGAAEVDTLGLDDSLERDFGLDSLARTELL
ARVERVCDSRVDEKALMAAETPRDLLRLAGKAEAPARLARVAAAPVPGSARTVASHRPPE
CAATLMDLIDWHVAAHGDEPYAAIAGADELSYRSILMGALSVAAGLTQQGLGAGERVALM
LPTGREFFEVFFGALYAGCVPVPLYPPARLSQIEDHMRRSAGILANAEATILVTLPPAKP
LLRLLHAQCPSLRRILAATDLHAVGNLTSVVRRGGADDIAFLQYTSGSTGNPKGVVLTHA
NLLANMRAMERAARVSATDVFVSWLPLYHDMGLIGACMGSLLVGFRLVLLSPTDFLARPA
SWLWAIHQNHGTLSAAPNFAYELCASRIDETDLVGLDLHTWRVAYNGAEPVSPETVEKFA
ARFARFGFNRGTMAPVYGLAECAVGLAFPPPGRGPRVDEVDRDALARRGIARAPESDKRY
ALRLVSSGLPLPGHQIRIADAAGRELPERTLGHVEFRGPSATTGYFRNPAATAGLFDGQW
LRTGDMGYLAGGELYLTGRLKDIIIRAGQHWFPQELEEAIGQLVGVRKGSVAVFPATDAR
SGTERLIVLAETRTQDDAEHARMRGDIAHLAVDLMGMPVDEILLVPPRTVLKTSSGKLRR
AACRELYERGELGGAPKAPWRQLLNLVVAGARIRVSRFQQKVGGWMWGAWAWLALALVGG
PACLLIALLPGRASCRAVARRAAHLGLMLTGLIPRTEGLSELDRNRPVVIVANHASYTDV
LLLTAVLPAHFTFVAKQELLQSSALALLLRHLGCAFVERFDPERGVEDTVVLEQRARAGE
SLVFFPEGTFRREPGLMPFRLGAFLCAARAQMPIVPITLVGTRSLLRDGRWWPSRTHLAV
LAGQAVHAPGDDWPSLLQLRDLARQAIRARLDEPDTTEE
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacgaataactccataccgcgcgcgactgtcgatgcgcaagaactgcttgcc
atcgtgcgccgcctggccgccgagttgcggccaggggcggcggaagtcgacacgctgggg
ctcgatgattcgcttgaacgcgattttggattggatagcttggcgcgcaccgaattgctg
gcgcgtgtcgagcgggtctgcgacagtagggtcgacgagaaggcgctgatggccgccgaa
actccccgtgacctgctgcgtctcgccggaaaggcggaggccccggcccggctcgcccgg
gtagcggcagcacctgtgccgggctcggccaggactgtggcctcccatcgtccgcccgaa
tgtgctgctacgctgatggacctgatcgactggcatgtggccgcgcatggcgacgagcca
tacgccgctatcgccggggcagatgagctcagctaccggtcgattcttatgggcgcactc
tcggtcgccgccggcctcacgcagcaagggctgggtgccggcgagcgggtggcacttatg
ttgccgactgggcgcgagttcttcgaggtcttcttcggcgcgctctatgcggggtgtgtt
ccagtgccactctatcctccggcccgcctgtcgcagattgaagatcacatgcggcgtagt
gctggcatcctagccaatgccgaggcgacaatcctggtcacgctgccgccggccaaaccg
ctgcttcgccttcttcatgcgcagtgtccgtccttgcgccgaatcctggcggctacggac
ctccatgccgtcggcaatctgaccagcgtcgtgaggcgggggggggccgacgacatcgcc
tttctacaatacacgtcgggaagtacaggcaaccccaaaggggtagtcctgacacacgcg
aacctgctcgccaacatgcgggcgatggaacgtgctgcgcgcgtcagcgcgacagatgtc
ttcgtgtcgtggttgccgctgtaccatgacatgggcctaatcggtgcttgtatgggtagc
ctccttgtgggcttccgactggtgcttttgtcgcccactgatttcttggcgcggcccgct
tcctggctatgggccatccaccagaatcacggcacgctgtccgcggcgccgaactttgcc
tatgaactgtgcgccagcaggatagacgaaacggacctggtgggtctggacctgcatacg
tggcgtgtggcgtataacggtgcggagccggtgagtcccgagacggtggagaaattcgcc
gcgcgtttcgcccgatttggcttcaaccgaggcaccatggcgcccgtctacggtctcgcc
gagtgcgcggtcggactggctttcccccccccagggcgcggcccgcgcgtcgacgaagtc
gatcgcgacgccctggcacgccgcggtattgcgcgagccccggagtctgacaaacggtac
gctctcaggttggtctccagcggactgccgctgcccggccaccagatccgtattgccgac
gcggccggccgcgagttacctgagcgcacgcttggacatgtggaattccgcggcccatct
gccaccacaggctacttccgcaatccggcggccactgccggcctgttcgatggtcagtgg
ttaaggacgggcgacatgggctatctcgcgggaggcgaactctatctgaccgggcgcctc
aaggacatcataattcgcgcgggacagcactggtttccgcaagagctggaagaagccatc
ggacagttggtgggcgtccgcaagggcagcgtggcggtgttcccggccaccgatgcgcgc
agcggcaccgaacggctgatcgtgctggccgagactcgcacacaggatgacgctgagcac
gcgcgcatgcgtggcgatatcgcgcacttggcggtcgacctcatgggtatgcccgttgac
gagatcctgcttgtgccaccgcgcacggtgctcaagacgtcgagcggaaagctgcgccgc
gccgcttgtcgtgaactatacgagcgcggagaacttggcggtgcgccaaaggcgccgtgg
cgacagctgttgaaccttgttgtggctggcgcgcgcatccgtgtttcgcggtttcagcag
aaagtcggtggctggatgtggggcgcctgggcatggttggctcttgccctggtgggaggg
ccagcatgtctgctgattgcgctgttgcccggtcgcgcctcatgtcgcgccgtcgcacgc
cgtgctgcgcaccttggtttgatgttgacgggcctgattccccgaactgaagggctgtct
gagctcgaccggaacaggcctgtcgtgatcgtggccaatcacgccagctataccgacgtg
ctgctgttgacggcagtgttgcccgcccacttcacttttgtggccaagcaggaactgctg
cagagtagcgctctggccctcttgttgcgtcacttgggctgcgccttcgttgagcgcttc
gaccctgagcgcggcgttgaggacaccgttgtccttgagcagcgtgctcgggcgggcgag
tctctcgtcttcttcccagaggggactttccgacgcgagccgggtctgatgccattccgg
ctgggtgcgttcctgtgcgccgcccgtgcgcagatgccaatcgtgcctatcacgctggtc
gggacccgctccttgctgcgggatgggcgctggtggccaagccggacgcacctagcggtc
ttggccgggcaggctgtgcacgcgccaggagacgactggccttcactgttgcagctacgt
gacttggcacgccaagcaatccgcgccaggttggacgagccggatactacggaggaatga

DBGET integrated database retrieval system