KEGG   Corvus cornix (hooded crow): 104687867Help
Entry
104687867         CDS       T03546                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104687867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 698 aa AA seqDB search
MAALKIGKVNWQSKLNKAAHHTSDYSSTEVILRRGQPFNISLNLKTTVQSWDNFTFIAST
GPSPSQQTKAIFTLSEEGASGWSATQEPGEPRCLNFTILSPADAVIGRYKLKLQVLVGNK
VSSKVLGQFVLLFNPWCPDDDVYMADEKERQEYVLNDSGIIFQGLEKDIQQEAWNYGQFE
EDILDISLAILDRSLNHREDPAVDVSNRNSPVYVSRVISAMVNSNDEKGVVEGKWSGKYR
SGTNPLRWSGSVTILRKWYRARYRPVRYGQCWVFAGVTCTVLRCLGIPTRVITNFNSAHD
KNLNLSVDKYIDMSGNTLHLSEDSVWNFHVWNESWFVRRDLGSFYDGWQVLDATPQEKSK
GIYQCGPASTRAIKEGDVNLDYDSPFVFAAVNADCVTWIRYSKKRKERIYSNTRKIGKFI
STKAVGTNSRVDVTANYKYPEGSLKERQVYKKALKLLGVRRPGKRTKIPRPRRGFSRAQP
AQTPSISGKLLLDASPVIGQDILLTLTLRNLISDFQTIKVKLKASAILYTRKPKAEILQL
HRSIKLGSEEVKEISFKILYSQYKNSLMDDRKILVTAVCQIKQGASLLVEKDIVLQDPFL
TIKVLGPAVVHRPVNVEVTFTNPLSDVVTDCVLRAEGSGLLKEQLRIHVERMAPMETSTV
QFEIFPYRRGTRQLQVDLVCTHFSDIKGFVMLDVAPAQ
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctaaaaataggaaaagtcaactggcaatccaagctaaataaagctgcacat
cacacctctgattacagcagcacagaagtaatcttgaggagagggcagcccttcaacatc
tctctgaacctcaaaacaacagtgcaatcttgggacaacttcacctttattgcaagcaca
ggaccatctccatcccagcagaccaaggccatatttaccctttctgaggagggtgccagt
ggctggagtgcaacccaagagcccggtgagcctcgctgcctgaacttcaccatcctcagc
ccagctgatgctgtcattgggcgatacaaactcaaactccaggtcctggttgggaacaag
gtctcttccaaagtcctgggccagtttgtgctactcttcaatccctggtgtccagatgat
gatgtctacatggctgatgaaaaggagcggcaggagtatgttctgaatgacagtggaatc
atatttcagggactggagaaagatatccaacaagaagcttggaactatggacagtttgaa
gaggacatccttgacatctctctggctatactggatcggagcctgaaccaccgcgaggac
ccagctgtggacgtctccaaccggaacagccctgtctatgtcagcagggttatcagtgcc
atggttaacagcaatgatgaaaaaggagtagtggaagggaagtggagtgggaagtaccgc
tcaggaacaaaccccctgcgatggagcgggagcgtgaccatccttcggaagtggtaccgg
gccaggtacagaccagtccggtacggccagtgctgggtctttgcaggagtcacatgcaca
gtactgagatgcttgggaatacctactcgtgttattacaaacttcaactctgcccacgac
aagaatctaaacctgagtgttgataagtacattgacatgtctggaaacactctacacttg
agtgaagacagtgtgtggaatttccatgtctggaatgaaagctggtttgttagaagagat
ctcggctctttttatgatggatggcaggttctggatgcaacgccccaggaaaaaagcaaa
ggtatctatcagtgtggtcctgcctccaccagagccattaaagaaggggatgtgaacctg
gattacgacagcccatttgtgtttgcagcagtgaatgctgactgtgttacttggattcgc
tatagcaagaaaagaaaagagagaatttattctaataccaggaagattggaaaatttatc
agcaccaaagcagtgggcaccaactcccgtgtggatgtcactgctaattacaaatatcca
gaaggatccttgaaagaaaggcaggtatacaagaaagcactgaagctgcttggtgtgaga
agacctggaaaaagaaccaaaattccaagacccagaagaggattttcaagggcacagcct
gcacaaacccccagtatctcagggaaactgctccttgatgcatctcctgtaattggccaa
gacatcctccttaccttgacactcagaaacttgatctcagattttcagaccataaaagtt
aaacttaaggcttcagccattctctacaccagaaaacccaaggcagaaattttgcagttg
cataggtctattaaacttggatctgaagaagtgaaagagatttctttcaagatcctctat
tcccagtataaaaactctctgatggatgacaggaagatcctagtgactgctgtgtgccaa
atcaaacagggagcctcgcttctagttgagaaggatattgtactgcaggatcctttcctc
accataaaggtccttggtccagctgtagtacacaggcctgtcaatgtggaggtcacattt
accaaccctctgtctgacgtggtgacagactgtgtgctgagagctgaaggcagtggcctg
ctcaaagagcaactccgaatccatgtggaaagaatggcccctatggagacctcaacagtg
caatttgaaatctttccctacaggaggggcaccaggcagcttcaggtggacttggtttgc
acccatttttcagacattaagggatttgtgatgcttgatgtggctcctgctcagtga

DBGET integrated database retrieval system