KEGG   Corvus cornix (hooded crow): 104688830Help
Entry
104688830         CDS       T03546                                 

Gene name
SETD1B
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccw00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104688830 (SETD1B)
Enzymes [BR:ccw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104688830 (SETD1B)
Chromosome and associated proteins [BR:ccw03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104688830 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     104688830 (SETD1B)
    COMPASS/SET1 complex (yeast)
     104688830 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 104688830
NCBI-ProteinID: XP_010396819
LinkDB All DBs
Position
Unknown
AA seq 1983 aa AA seqDB search
PRSGWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKKGQHKLYRYDGQHFSMPNSGIA
PVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLADMC
KKYGEVEEVEILYNPKNKKHLGIAKVVFATVKGAREAVQHLHNTSVMGNIIHVELDTKGE
TRMRFYELLVSGLYTPQTLPVGTEQDVSPTGNEALQLTDSLKRMKDSSLSSAGSSVTPNS
STPFSHDTAYSSCRQDTPNSYSQFTPQSQGTPHTPRLGTPFSQDSTYSSRQTTPVYHFGQ
DSGYKPRRHETKFTDAYNRRPGHHYVHNSAGVFRGTEHQFSTFKSHQQEPVQFSHTPPLS
HSSSSSYKSAFSPYQAPAVFPQSDEQPFPQTSRETEYRRPAPPPTEMVVESSAAPSIDFV
PVKEKPEEPPPLPDSNSVPEPSTASFSQTPERSETPGTPTMESEMQHNSLDSRIEMLLKE
QRTKLPFLNEHDSDNEVRMEGSPISSSSSQLSPIPTYGSNSQPGFRGQTPSSRPSSTGLE
DISPTPLPDSDDDEPIPGTASLSQNSRGTSEASMTPIDQLSRTSKTEILEAKEMVPGDQT
PTSEKMDEGQHSSGEDMEISDDETNPAPITSAECAKTIVVNSSVSNTAVMAPSIPPLPPP
GFPPLPPPPPPQPGFPMPPPLPPPPPPTHPAVTVPPPPLPAPPGVPPPHILPPLPPFHPG
MFPVMQVDMISVLGNQWGGMPMSFQMQTQMLSRMMQAQNTYQYPPFITGRMQFVNLPPYR
PFSMGAALARGQQWPPLPKFDPSVPPPGYEPKKEDPHKATVDGVLLVIVKELKAIMKRDL
NRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGGELEEKPKPKDRIASCLLENWNKGEG
LGYEAIGLGIGLRGAIRLPSFKVKRKEPPEAASAGDQKRIRPSTSVDDEDEESERDRDAS
DTTSDLSKKDAEAVGLRRRPARPLELDSEGEEGDETSGKEEESSSEKEEEQEEEGGLVKA
APGKEEEEDEEDEDDEDEDDDEDEDEDDEEETGIDTSDKEEEQDSEEDVASPSSSKAEVE
SSDESEDSSEFESSSDSDDEDEEDDDDEDEEEEEEEEVAEDQGREAMVAEPEHEPAGHEL
PEDERETILDLYPVDDYMDATGLGLAEPALAVKDEGSEEIKAEESECGQVPGASLAAETL
KHLVMERDQETKLALSPICRPEEESEPTSMLEAEVQEGPKPASQDEEATLCISAPVGVFG
EPLPSKSSFFGKSEDSTLEGRVKAKPPSAAEEDERLPRTPGREVMIHSETETLLLPAHKV
PSSMLPLPSTPGKEESLVPPEKFPEQLMVTKTSVEEEIPRTPGRDILAKSSHPLAKSQST
DTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQSPGINSGIPRTPGRDFNFTPTFPEA
GATIPCLLSGKKQSEDELEEKPSKEPLGASLTISMNSVPSPIPFASPPQADFHMDMGLPP
DEPIPVAALPCMHGDGRMPIEECKAEVKPGLLSPELPPGASILPPPPPPSVLPKRRPGRP
RRSPPSVLSLDVYPGKTIEPPPVPVALVEGAMGKELLSGHPDAYYGLKDPEAVTLDFRND
GFHEKIAAETVAEKLPFKELENQWNEDFKEEEAHAKPKRQWRRQKKTSEELPVIPSPEYS
PPRPQFRPRSEFEEMTILYDIWNGGIDEEDIKFMCITYDRLLQQDNGMDWLNDTLWVFHP
STSFSTPKKKKRDDGMREHVTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSI
PAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFA
MEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARF
INHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRG
TLN
NT seq 5952 nt NT seq  +upstreamnt  +downstreamnt
ccgcgttcaggttggatcaacggaatggagaacagcacgcaagccagcacttctgtcgag
aaaagaaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaagga
cagcacaaactctaccgttacgatgggcaacatttcagcatgcctaactcgggaatcgct
cctgtggattgtgtcagggatcccagaatagggcgaatatggaccaaaactaaggagttg
gagttgtctgtccccaaattcaagattgatgaattttacgtggggccagtgcctcccaag
caggtcacctttgccaagctgaacgacaacatccgtgaaaactttttggccgacatgtgc
aagaaatacggcgaagtggaagaggtggagattctctacaaccccaagaacaagaagcac
ctgggcattgccaaagtcgtctttgccactgtcaagggtgcccgggaggctgtgcagcac
cttcacaacacctctgtcatgggcaacatcatccacgtggagctggatacaaaaggtgaa
acccgcatgagattctatgaactgctcgttagtggtctttacactcctcagaccctccct
gtaggcaccgaacaggacgtgtccccgactgggaacgaagctctccagttgacggattcc
ctgaagcgcatgaaggacagttccctttcttccgcgggatcctccgttaccccaaacagc
agcacgcccttttcccatgacacagcctattccagctgtcggcaagacaccccaaactcg
tacagccaattcaccccgcagtcccaaggaacgccccacaccccacgcttggggacgccg
ttctcccaggattccacctattccagccgtcagacaacacccgtgtaccattttgggcag
gacagtgggtacaaaccccggaggcacgagacgaaatttacggatgcgtacaaccgtcgc
ccgggacaccactacgtgcacaactcggcgggggtgttccgaggcacggagcatcagttt
agtacattcaaatcccatcagcaggagccagttcagttctctcacactcctcccctgagc
cactctagttcttcgagctataaatctgccttctctccctaccaagcaccagctgtattt
ccccaatctgatgagcagccgtttccccaaacttccagggagacagagtaccggagacct
gctccacctcccaccgagatggttgtggaaagcagtgctgccccaagcatcgattttgtc
ccagtgaaggagaagccggaggagcctccgcccttgcccgactcgaactctgttcctgaa
ccgagcacagcatccttctctcagactccagagaggagtgagacccctggcacccccacc
atggagtctgaaatgcaacataacagtttggactcaaggattgagatgctcttaaaagag
cagagaacaaagttaccctttcttaatgagcatgactcggataatgaggtccgaatggaa
ggtagccctatttcctcctcttcttcccagctctcccccatcccaacatatggttcgaac
tctcagcccggtttcaggggtcagacgccttcctcgcgcccttccagcacaggcttggag
gacatcagccccacaccgttacctgactctgatgatgatgagcccatccctgggacagct
tctctgagtcagaattcccgggggacatcagaggccagcatgactcccatcgatcagctg
agcaggacctccaaaactgaaatcttggaggctaaagaaatggtgcctggtgatcagact
ccaacatcagaaaaaatggacgagggtcagcattcctcaggggaggacatggaaatctct
gacgacgagaccaaccctgcgcccatcaccagcgcggaatgtgccaaaaccattgtggtg
aactcctccgtcagcaacacggccgtgatggccccgtcgatccccccgctgccaccaccg
ggattccctcctcttcctcctccgccacctccacagccgggcttcccgatgcctccgccg
ctgcctccgccgccgccgcccacccacccggccgtcaccgtccccccgccgccgctgccc
gccccacccggggtccctccgccccacatcctgcccccgctccccccgttccatcctggc
atgttccccgtcatgcaggtggatatgatcagtgtcttgggcaaccagtggggtggcatg
ccaatgtcgttccagatgcaaactcagatgctgagccgcatgatgcaggcacagaacacg
taccagtatcctcctttcataacaggccggatgcagtttgtgaatcttcctccctaccgc
cctttctcgatgggagccgctcttgcccgcgggcagcagtggccaccactgcccaagttt
gacccctcggttccacccccgggttatgagccgaagaaggaggatccccacaaagccact
gtggatggagtcctcctggtcatagtgaaggaactaaaggccatcatgaaaagggacctg
aaccgcaagatggtcgaagtggtggcattccgggcatttgatgactggtgggacaagaag
gaacgtctggcaaaggcatctctcactccagtgaagtctggaggagaattggaggaaaaa
ccaaagccgaaggatcgaatcgcctcttgtcttttggagaactggaacaaaggagaaggg
ctgggatatgaggcaatcggcttgggcattgggttacgaggggccatccggctgccatcc
ttcaaggtgaaaagaaaggagccacctgaagctgcctcagcaggagatcagaagagaatc
cggccttctacttctgtggatgatgaagatgaagagtcggagagggacagggatgcttct
gatacaacatctgacctgtcaaagaaggatgcagaggcagtggggctgcgacggcgacca
gcaaggccattggagctcgacagcgagggagaagagggagatgagacatcagggaaagaa
gaggagtcctcctcagagaaggaagaggagcaggaagaagagggaggcttggtgaaagca
gcacctggcaaggaggaagaggaggatgaggaggatgaagatgatgaggatgaagatgat
gatgaagacgaggatgaagatgatgaggaggagacgggcatagacacaagtgacaaggag
gaggagcaggactccgaggaggatgtagcaagtccctcgtcttccaaggctgaagttgaa
tcatctgatgaaagtgaggactcctctgaattcgaatcaagttctgactcggatgatgaa
gatgaggaggatgatgatgatgaagatgaggaggaggaagaggaggaagaggtggctgaa
gatcaaggcagagaagccatggttgctgagccagagcatgaacctgctggtcatgagctt
cctgaggatgagagggagactattttggacctgtatcctgtggatgactacatggatgca
acaggcttgggacttgccgagccagctttggcagtgaaagatgaaggcagtgaagaaatc
aaggcagaggaaagtgagtgtggccaagtcccgggggcatctcttgctgctgaaactctg
aaacacttggttatggaaagagaccaggagacaaaacttgcactctctcccatctgtagg
ccagaggaagagtccgaacccacttccatgctggaggcagaggtacaggaaggtccaaag
cctgcatctcaagatgaggaggcaacgctctgtatctctgctccagtgggagtctttgga
gaacctctgcccagcaaaagcagtttctttggcaagtctgaggacagcactttggaaggc
cgagttaaagcaaagccgccatcggcagcggaggaggacgagcggctgcctcgtacgcct
ggacgggaggtgatgatccactcggagactgagactcttctgcttccagcccacaaggtg
ccatcctccatgcttcccctgccatcaactcctggcaaggaagaatctttagtccctcca
gaaaagttccctgaacaattaatggtgaccaaaacatccgtggaagaagagattcctagg
actcccgggcgggacattttggccaagtcttcacaccccctcgcgaagtcacagagcacg
gacactgttccagccacgccaggaagtgatgctccccttacaggaagtagcttgaccctc
agttcccctcaagtcccagggagccccttttcctacccatcccaatctcctggcattaac
agtggcattcctcggactcctgggagagatttcaatttcacccctactttcccagaggct
ggtgctaccattccttgccttctgtctggcaagaaacagtcagaggatgaactagaggag
aaaccctctaaagagcctcttggtgcttcccttacgatcagcatgaacagtgttccttcc
cctatcccctttgccagccccccgcaagcagatttccacatggacatgggtttgccacct
gatgagccaatacctgtagcagccctgccgtgcatgcatggagatggaagaatgcccatc
gaggaatgcaaggcagaagtgaaacctggtttgctctccccagaactaccccctggggct
tctattcttcctcccccaccaccaccttctgttcttcccaaaaggaggccgggtcggccg
aggcggtccccaccttctgtcctctcgctggatgtgtacccaggcaaaaccatagaacct
cctcccgtgccagtggccttggtggaaggtgctatgggcaaagagctgttgagtggacat
cctgatgcctactatggactgaaagaccctgaagccgtcaccctggacttcaggaatgat
ggtttccatgagaaaatagcagctgagacagttgcagagaaactgccattcaaggaactg
gagaaccagtggaatgaagacttcaaggaagaagaagctcacgcaaaacctaagagacag
tggcgaaggcagaagaagacatctgaggagctgccagtgatcccttcccccgagtattcc
ccgccccggccgcagttcaggccgcgctccgagtttgaggagatgaccattttgtatgat
atctggaacggaggcatagatgaggaggatatcaaattcatgtgtatcacatacgaccgc
ttgttacagcaggacaatggtatggactggctcaatgacaccctgtgggttttccatcct
tctaccagcttttctacccccaagaagaagaagcgggatgacgggatgcgggagcacgtg
acgggctgtgcacggagcgaaggctattacaaaattgataagaaggacaaactcaaatac
ctcaacaatagccgagcttttgcagaggagcctccagctgacacacagggtatgagcatc
cctgcccaacctcatgcttccacccgggctggttccgagaggcgatcagagcaacgcagg
ctcctctcctccttcactggtagctgtgacagtgacctgctcaagttcaaccagctcaag
ttccggaagaaaaagctaaaattctgcaagagtcacattcatgactggggcctttttgct
atggagcccattgcagctgatgagatggtgattgaatacgtgggtcagaacatcaggcag
gtcattgctgacatgcgtgagaagcgatacgaggatgaaggcatcggcagcagttacatg
ttcagagttgaccacgacaccatcatcgatgccaccaaatgcgggaacttcgccaggttt
atcaatcacagctgcaatccaaattgttatgctaaagtgatcacggtggagtctcagaag
aagatcgttatctactccaagcagcacatcaatgtgaacgaggaaattacctacgactac
aagtttccaattgaggatgtaaaaatcccgtgtctctgtggctctgagaactgcagggga
accctgaactga

DBGET integrated database retrieval system