KEGG   Corvus cornix (hooded crow): 104698643Help
Entry
104698643         CDS       T03546                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     104698643 (ACE)
Peptidases [BR:ccw01002]
 Metallo Peptidases
  Family M2
   104698643 (ACE)
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104698643 (ACE)
CD molecules [BR:ccw04090]
 Proteins
  104698643 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1238 aa AA seqDB search
MTLTPAPKPLLGWWHVPGLVLSPHVPSQVKASLEEQNFTELWGKKAKELYGDKWNNFSDP
LLRKIIGSIQTLGPSNLPLEKREQYNTILSDMDKTYSTAKVCLPNGTCWDLEPDLSDIMA
TSRSYKKLLYAWEGWHNAAGNPLRPKYEEFVKLSNEAYMMDGFEDTGSYWRSWYDSDSFE
KDLERIYSQLEPLYLNLHAFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLM
IPYPEKPNLDVTSTMVEQRWNATHMFRVSEEFFTSLGLLEMPSEFWEKSMLEKPTDGREV
VCHASAWDFYNRKDFRIKQCTSVTMEQLFTVHHEMGHIQYYLQYKDQPVSFRGGANPGFH
EAIGDVLSLSVSTPSHLKKIGLLSNATEDEESNINYLLKMALEKIAFLPFGYLIDQWRWN
VFSGRTPPSRYNYDWWYLRTKYQGICAPVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQ
FQFHKALCHAANHNGSLHTCDIYRSKEAGAKLREVLKAGSSKSWQDILLNLTGTGQMDAG
PLLEYFSPVTRWLEEQNNKTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYN
STAEEVWNAYTEASWAYNTNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDQSV
TRILKKLSVIERAALPESELKEYNTLLSDMETTYSVAKVCRQNKTCHPLDPDLTDIMATS
RDYDELLFAWKGWRDASGKKMRSNYKRYVELSNKAAMLNGYKDNGAYWRSLYETPTFEED
LERLYQQLQPLYLNLHAYVRRALYRKYGAEHINLKGPIPAHLLGNMWAQSWSNIFDLVIP
FPDATKVDATPAMKKQGWTPKKMFEESDRFFTSLGLIKMPQEFWDKSMIEKPSDGREVVC
HASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEA
VGDVMALSVSTPKHLHSINLLDQVMENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVF
DGRIKEDEYNKEWWNLRMKYQGLCPPALRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQ
FHHALCNAARHEGPLHTCDIYESQEAGKILGDALKLGFSKPWPEAMQLITGQSNMSAEAL
MSYFKPLMTWLEKENEKNGEVLGWPEYSWTPYTATPDQDGSSKTDFLGMSLTESQATAGG
WVLLALALLFLITTIFFGIKFSSARRKAFKSSSEMELK
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgactctgactccggcccccaaaccattgcttgggtggtggcatgtcccagggctggtc
ctgagcccccatgtcccctctcaggtcaaggcatccctggaggagcagaacttcacggag
ctgtgggggaagaaagccaaggagctctatggcgacaagtggaataacttcagtgaccct
ctgctgaggaaaatcattggctccatccagaccttgggaccctccaacctgcccctggag
aagagagagcagtataacaccatcctgagcgacatggacaaaacctactccacggccaag
gtgtgcttgcccaatggcacctgctgggatctggagccagacctctcggacatcatggcc
acctcccgcagctacaagaagctgctctacgcctgggaggggtggcacaatgccgcaggg
aacccactgcgccccaagtacgaggagttcgtgaagttgagcaacgaggcctatatgatg
gatggattcgaagacacaggcagctactggcgctcctggtatgactcagactcctttgag
aaggacctggagcgcatctacagccagctggagccactctacctcaacctgcacgccttt
gtccggaggaagctgtatgatcgctatgggcccaaatacatcaacctgaagggtcccatc
cctgctcacctcctggggaacatgtgggctcagcagtggaacaacatctatgacctgatg
atcccctaccctgagaagcccaaccttgatgtcacgagcaccatggtggagcagcgctgg
aatgccacccacatgttccgggtctcagaggagttcttcacctccctggggcttctggag
atgccctctgaattctgggagaagtccatgctggagaagccgacagatgggcgggaggtg
gtgtgtcacgcctcggcctgggacttctacaaccgcaaagacttcaggatcaagcagtgc
acgtcagtgaccatggagcagctgttcacagtgcaccatgagatgggccacatccagtac
tacctgcaatacaaggaccagcctgtgtccttccgcggcggggccaatcctggcttccat
gaggccattggcgatgtcctgtccctctctgtctccacccccagccacctcaagaaaata
ggtctcctcagcaatgctactgaggatgaagagagcaatatcaactacctgctgaagatg
gccctggagaagattgccttcctgccctttggctacctcattgaccagtggcgctggaac
gtgttcagtggccgcacgcccccgagccgttacaactatgactggtggtacctgagaacc
aaataccagggaatctgtgctccggtttcaaggaatgaaagcaactttgaccctggagca
aagtaccacatcccagggaacactccttacatcaggtactttgtgagcttcatcctccag
ttccagtttcacaaggcgctgtgccatgcggccaatcacaacggttccctgcacacctgt
gacatctacaggtccaaagaggctggagccaaactcagggaagtgttgaaagctgggtcc
tcgaagtcgtggcaggatatcctcttgaatctcactggcacaggtcaaatggatgctgga
ccccttctggagtatttcagccctgtcaccaggtggcttgaggagcagaacaacaagacc
aatgaggtgctgggctggcctgagtttgactggcgtccccctgtccctgaaggctaccct
gaaggcattgacaaaatagcagatgaggcacaagctaaagaattcttgtctgagtacaac
agcacggccgaagaagtgtggaatgcctacaccgaggcatcctgggcctacaacaccaac
atcaccgaccacaacaaggagatcatgctggagaagaacttggccatgtccaagcacacc
ctggagtacggcatgagggccaggcagtttgacacctctgatttccaggaccaaagtgtc
acccgcatcctcaagaagctgagtgtcattgagagggcagccctgcctgagagtgagctg
aaggagtataacaccctcctctcagatatggagaccacgtacagtgtggccaaggtctgc
agacagaacaaaacctgtcacccactggatcctgacctcacagacatcatggccacctct
cgggactatgatgagctcctcttcgcctggaagggctggcgggatgcttctgggaagaag
atgaggagcaactacaagcgatacgtggaactgagcaacaaggcagccatgctcaatggc
tacaaagacaacggagcctactggagatccctctatgagacgcccacctttgaggaagat
ctggagaggctgtatcagcagctgcagcccctgtacctcaacctgcacgcttatgtacgc
cgagccctgtacagaaagtatggtgcagagcacataaacctgaagggtcccatccctgcc
catctgctaggcaacatgtgggctcagtcatggtccaacattttcgacctggtgatacct
ttccctgatgccaccaaggtggatgccaccccggccatgaaaaaacagggctggacaccc
aagaaaatgtttgaagagtcggaccgtttcttcacctctctgggcctcatcaaaatgcca
caggaattctgggacaagtccatgatcgagaaaccatcggatgggcgggaggtggtgtgc
cacgcctcggcctgggatttctacaatcgcaaggacttcaggatcaagcagtgcacggtg
gtgaacatggacgacctcatcacagtgcatcacgagatgggccacgtccagtacttcctg
cagtacaaggaccagcccgtctccttccgtgacggggctaaccctggcttccacgaggct
gttggggatgtcatggccttgtctgtctccacccccaaacacctgcacagcatcaatctg
ctggaccaagtcatggaaaacgaagaaagtgatattaactacctgatgagcatcgccctg
gacaaaatcgccttcctgccctttggatacctcatggaccagtggcgctggaaggtgttt
gacgggcgcatcaaagaggatgagtacaacaaggagtggtggaacctcaggatgaagtac
cagggcttgtgcccaccagcactgaggtctgaagatgactttgatcctggggcaaagttt
cacatccctgccaatgtcccctacattaggtacttcgtcagctttgtgatccagttccag
ttccaccacgcactctgtaatgcagccaggcacgagggtcccctgcacacctgtgacatc
tacgagtctcaggaggctgggaagatcttgggggatgccctgaagctgggtttcagcaag
ccgtggcccgaagccatgcagcttatcacggggcagtccaatatgtcagcagaggccctg
atgagctacttcaagccactcatgacatggctggagaaggagaatgagaagaacggggag
gtcctgggctggcccgagtacagctggactccttacacagccactccagaccaagatggc
tccagcaaaactgatttcctgggaatgtccctgaccgaaagtcaagccacagcaggtggc
tgggtcctgcttgccctggcactcctcttcctgatcaccaccatcttctttggtatcaag
ttctcctcagccaggagaaaggccttcaaatccagctcagaaatggaactgaaataa

DBGET integrated database retrieval system