KEGG   Corynebacterium diphtheriae HC04: CDHC04_0446Help
Entry
CDHC04_0446       CDS       T01696                                 

Gene name
nanH
Definition
(GenBank) sialidase-1
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CDHC04_0446 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CDHC04_0446 (nanH)
Enzymes [BR:cda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CDHC04_0446 (nanH)
Bacterial toxins [BR:cda02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CDHC04_0446 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
460134..462308
Genome map
AA seq 724 aa AA seqDB search
MHSSNRTYSRAILGLSAALTLSFTSLVAPVNAEEPETVVPAIAEQEGEAPATLPSAETGL
FDAAPPKPVARGAAGDLQLPAVNEEKVFEEGRVIRAPEPDQSRCYRIPALVTAKNGDLLL
AFDNRYGGGEGAKTWCRDAPYHNKERKNTQQMQTDIQLYKSVNNGKSFEEFDFIAKGTED
SRNLSYTDPAIVVDRTNGKIFAFFVRAYDHRVGQASAGTNGLDVDAQISRRDVQDTVVVE
SRDNGRTWQNMRLISDLTKQVKSISRPGETFNGHGRFVTSGAGIQLQYGPNSGRLIVPIA
VDIDPSDSAKFVNLTIYSDDHGSNWKIGEGTAGDSTYSGDESKLVELSDGKLMMSSKDND
KTRWVAYSEDQGEHWSVPVRKIIAPPQYPNQHNTGINVGLIRAYPNAPENSAAAKVLLYS
APIDSRRGSDFDKDGRKNGWVMGSCDDGKTWSFGRQVEKNRFQYSSMTVMADGNIGMVYE
SGTREEGMNLKFAKFNMAWLGADCLSNEALGLTGDIDKEIVAAQEKAAAATKEAQEAAEK
VEKLTEELAAARKENDELKTQVKESEVAVGDLADKVFKLENAVTEAKEKATVAEKAASDA
LAKLQEAESTAEEQKAKAESAAAEAQALREKLEKLEGSILTAKENSEAEESADLSSTARD
AADTARRAATDANGALSGQKQNEEKPAMGLMGILKVLAGIIPLVAIIATIFQTFRLPFNI
PGMR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgcattcctcaaaccgaacctacagccgtgcaattctcggcctcagtgcagcattaaca
ctttcattcacatcgcttgtcgcgccagtgaatgcagaagagcccgaaactgttgtgcct
gctatcgcagaacaagaaggagaagcacctgcgacattgccgagcgctgaaactggactc
ttcgatgctgcgccaccaaagcctgttgcccgcggggcggctggagatctgcaattgccg
gcggtgaatgaagaaaaagtctttgaagaggggcgagttatccgagctccggagcctgac
cagagtcgatgctatcgaattccggcgttggtaacagcgaagaatggtgatcttcttctt
gcttttgataatcggtatggcggtggagagggagctaagacttggtgtcgagatgctcct
taccacaataaagagcgtaagaatactcaacaaatgcaaactgatatccagctatataaa
tccgtgaataatggaaagtcatttgaggagtttgattttattgctaaaggtactgaagac
tctcggaatttgtcatatacggaccctgcaattgtagtagatcgaaccaatggaaaaatc
ttcgcattttttgtacgcgcttatgatcatcgggtggggcaagcgtctgcagggacgaat
ggtctcgatgttgatgcacaaatctcaaggagagatgttcaagacactgtagtcgtcgaa
tcgcgagataacggacgcacatggcaaaacatgaggctaattagtgatcttactaaacaa
gtcaagagcatttcgcgacccggtgagacatttaacgggcatggacgatttgtaacttct
ggtgcgggtatccaacttcagtatggtcccaactcgggaaggctgattgtacctattgct
gtcgatattgatccgagtgattcggcaaaatttgtcaatcttacaatttattccgatgac
catggatcaaattggaaaattggtgagggaaccgcaggcgactcaacttattctggcgat
gaaagtaagcttgtagaactatccgatggaaagcttatgatgtcgtctaaagataacgat
aaaacccgttgggtagcctattctgaagatcaaggtgaacactggtctgttcccgtgcgc
aaaattattgcgcctccgcagtatcctaatcagcacaatacaggtattaacgtcggcctt
atccgcgcatatcctaatgctcctgaaaatagcgcagctgcgaaagtgttactatattcc
gcgccaattgattcacggcgtgggagtgactttgataaagacggtcgtaagaatggctgg
gttatgggttcttgcgatgacggaaagacatggtcctttgggcgtcaagttgaaaagaac
cgttttcagtattcaagcatgacggttatggcggatggcaacatcggtatggtctacgaa
tcaggtacccgtgaagaaggaatgaacctgaaatttgccaagttcaacatggcatggcta
ggcgcagattgcctcagcaatgaggcattgggtttgacaggcgatattgacaaggaaatc
gtcgcggcgcaagaaaaggctgctgctgcgactaaagaagctcaagaagctgcggagaag
gttgaaaagttaactgaagagttggctgctgctcgtaaagaaaatgacgagctcaagact
caggtaaaggaatctgaagtagctgttggggatctagctgacaaggtatttaagctggag
aacgccgtcacggaagcaaaagagaaagctactgtggctgaaaaagcagcatccgacgct
ctcgctaaactgcaagaagctgagtcgactgcggaagagcaaaaggctaaggctgaatct
gcagccgcagaagctcaagcattgcgtgaaaagctggagaaacttgaaggaagcattctt
actgcaaaggagaattcagaagcagaagaaagcgctgatctatcaagtacagcgagggat
gctgctgatacagctcgtcgcgctgctacggatgcaaacggtgcactttctggtcaaaag
caaaatgaagaaaagccagctatgggcttgatgggaatcttgaaagtgcttgcggggatc
attccactggtagcgatcattgcgactatattccaaacattccgtttgccttttaacatt
cctggaatgaggtag

DBGET integrated database retrieval system