KEGG   Corynebacterium diphtheriae BH8: CDBH8_0280Help
Entry
CDBH8_0280        CDS       T01698                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CDBH8_0280
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CDBH8_0280
Enzymes [BR:cdb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CDBH8_0280
Bacterial toxins [BR:cdb02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CDBH8_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(278177..280213)
Genome map
AA seq 678 aa AA seqDB search
MTTTTGALTITFATTCDGPLAHIPHHLDLNIIHGRIQGTTAHRRIDAEDPDGLDDGLPHH
LCLSVDTTGTHLFIDGYEAFSITQTEWFDTSELTLNPHGNLTIIDHQILNHAPTPRQARN
LAPAAEPLVWFAGSHLSTRDTQRISHLTHGSLRLLMKTRGTGQGGVAFQAHTINGDLTLE
IIDGTLIFSVRCHDEDYVRITAPGRWDDGHIYDVVIVCGRGATDIYVDGQQLIHSPGAAF
FNDLSGELSVHIGTSASGVRLFGEVQSGMIYPHVFNHHQVQRLASVEPIATQALFDCLLD
GAQSYRIPSLITTDSGVIIAGADKRVSIANDAPNDIDFVLRRSVDGGRTWQPPRTILQLP
DTACVTDSVLLQDHTTGRIFAFLDQFPAGIGQPNAALGTGFDTDGNRIGHFADGSTCTMP
HEVDQLEASFFGDPHNAPPGTVFQHPSCHLWMLSSDDDGQTWSTPRDLTPDIKEEWMRFC
GTSPGNGIQLQRGTHAGRLLIPMYYTKGDQFFAAALYSDDHGHTWHRGESPELEMFESTL
VEANDGSVLLWARNQHPSGAVAHARSTDGGHSWSQVTFNPNVPEIFSQPNALRVTNPDAI
IFANASQLLPFRGRGVIRMSTNDGTSWQHNRVFNPRHYVYQCMTQLPDGSIGLLWEREMQ
GLFFSIIPMTWIMQGYAL
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacaaccggcgcactcaccatcactttcgccaccacctgcgacgggccactc
gcccacatcccccaccacctcgacctcaacatcatccacggacgcatccaaggcaccacc
gcccaccgccgcatcgacgccgaagaccccgacgggcttgacgacggcctcccgcaccac
ctatgcctcagcgtggacaccaccggaacccacctctttatcgacggctacgaggcattt
tccatcacccaaaccgaatggttcgacacctcagaactcactctcaacccccacggcaac
ctcaccatcatcgatcaccaaatcctcaaccacgcccccaccccacggcaagcgcgcaac
ctcgcaccggcagccgaacccctcgtctggttcgccggcagccacctcagcacccgcgac
acccagcgcatatcacacctcacccacggctcgctgcggctacttatgaaaacccgcggc
accggccaaggtggcgtggccttccaagcacacaccatcaatggcgacctcaccctcgaa
atcattgacggcaccctcatattcagcgtgcgatgccacgacgaagactacgtgcgcatc
accgcgccggggcgctgggatgacggccacatttacgacgtcgtcatcgtgtgcgggcgc
ggagccaccgacatctacgtcgacggccagcaactcatccacagcccaggggccgccttc
tttaatgacctgtcaggtgagctctccgtccacattggtacctccgccagcggtgtgcgc
cttttcggcgaggtgcaatcgggaatgatctacccccacgtgttcaaccatcaccaagtc
cagcgcctcgccagtgtcgaaccgatagccacccaagcgctcttcgactgcctcctcgac
ggggcacaaagctaccgcattccctcgctgataaccacggattccggtgtcattatcgcc
ggtgccgacaagcgcgtaagtattgctaacgacgcccccaacgacatcgacttcgtacta
cgccgaagcgtggatggcggccgcacatggcaaccgccacgcacaatcctgcagctcccc
gacaccgcctgtgttaccgactccgtcctgctccaagaccacaccaccggccgcatcttc
gcctttcttgaccaattcccagcagggatcggccaacccaacgccgccctcggcaccggc
ttcgacacagacggcaaccgcattggacactttgccgacggcagcacctgcaccatgcca
catgaggtggatcagctggaggcgtcgtttttcggcgatccccataatgcacccccaggc
accgtcttccagcaccccagctgccacctatggatgctcagcagcgacgacgacggccag
acatggagcaccccacgcgatctcaccccagatataaaagaagaatggatgcgcttttgc
ggcacctcgccaggaaacggcatccaactgcaacgcggcacccatgcaggccggctgctt
attccgatgtattacaccaaaggcgaccagttcttcgccgccgcactctacagcgacgat
catggccacacgtggcatcgcggtgaatccccagagctcgagatgttcgaatccacgctg
gtagaggcaaacgacggcagcgtgctgctatgggcacgcaatcaacacccctccggcgcg
gtggctcatgcgcgcagcaccgacggcggccactcgtggtcacaggtcacgttcaacccg
aatgttccagagattttttcccagcctaacgcgctgcgcgtgaccaaccccgatgccatc
atttttgccaacgcctcccagctgttgccgtttcgcgggcgcggagtgatccgcatgtct
actaacgacggcacctcttggcagcacaatcgcgtgttcaatcctcgacactacgtgtat
cagtgcatgacccagcttcccgacggttccatcggtctattgtgggaacgcgaaatgcag
ggactgtttttcagcatcattcccatgacatggatcatgcaaggctatgccctttaa

DBGET integrated database retrieval system