KEGG   Corynebacterium diphtheriae HC02: CDHC02_0512Help
Entry
CDHC02_0512       CDS       T01694                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDHC02_0512 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CDHC02_0512 (alr)
Enzymes [BR:cde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CDHC02_0512 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cde01011]
 Precursor biosynthesis
  Racemase
   CDHC02_0512 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
516808..517956
Genome map
AA seq 382 aa AA seqDB search
MNLLETRISCDAIAANTRRLKDMVAPAQLMCVVKADGYNHGAPEVATVMARNGADQFGVA
TLAEAHQLRDAGITLPILCWIWSPEQDFSAAIDRDIDLAAVSMDHVRALIAEAVRRPAGT
RVRVTVKIDTELHRSGIDEANWTEAFELLHACPQVNVTGVFSHLACADDLESDYTDHQAE
VFRRAIAAGRRVGLDLSVNHLAASPATLTRPDLHFDMVRPGLALYGHEPIAGLDHGLREA
MTWIGSVTVVKPIAAGQGTSYNMTWHAPADGYLCVVPVGYADGLPRNVQGHLEVTIAGTR
YPQVGRVCMDQIVVFLGDNSRGVAPGDEAIIFGPRDTQAMTVTELACATGTINYEILCRP
TGRSHRTYSDLDAVSPTHPTES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgaaactcgcatctcgtgcgacgccattgctgcgaacacgcgacgttta
aaagacatggttgctcccgctcagctcatgtgtgtagtaaaagctgacggctacaatcac
ggtgccccagaagttgctactgtgatggcgcgtaacggtgccgaccaatttggtgtggca
acgcttgcggaagcacatcagctacgagacgcgggtatcactctccccatcctgtgctgg
atctggtcacccgagcaggacttttccgccgccattgaccgtgacatcgacttagccgcc
gtcagcatggatcacgttcgtgcactgatcgcagaggctgtgcgtcgtcccgcaggtacc
cgagtgcgggtgaccgtgaaaattgacacggaacttcaccgatctggaattgacgaagca
aactggacagaagcctttgagcttcttcatgcttgcccccaagtcaacgtcacgggcgta
tttagtcacttggcatgcgcagacgacttggaatcggactacaccgaccaccaagcagaa
gtattccgtagggcgattgctgcaggtagacgcgtaggacttgacctttctgttaatcat
ctagcggcatcaccagcaacactaacccgccccgacttgcactttgacatggtccggcct
gggcttgccctctatggtcacgagccgatagcagggctcgaccatgggctgcgcgaagcc
atgacatggattggttcagtaacagtggtcaaacccatcgcggcaggccaaggaaccagc
tacaacatgacatggcatgcgcccgcagatggctacctctgcgtggtgccggtgggctat
gcggacggattaccgcgcaacgtacaaggacatttagaagtaacgatcgccggcacgcgc
tacccacaagtagggcgcgtttgtatggaccagattgtggtattccttggcgataattcc
cgcggtgttgcccctggtgatgaggcaattatttttggtccaagagatacccaagcgatg
accgtcacggagctggcctgcgctacgggaaccatcaactatgaaatcttgtgccgcccg
accggacgaagccatagaacctatagtgatcttgacgccgtttcgcccacgcaccctact
gaaagctga

DBGET integrated database retrieval system