Camelus dromedarius (Arabian camel): 105089154 Help Entry 105089154         CDS       T04642                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05202   Transcriptional misregulation in cancer cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105089154  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105089154   09163 Immune disease    05322 Systemic lupus erythematosus     105089154   09165 Substance dependence    05034 Alcoholism     105089154  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     105089154   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cdk04147]     105089154 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105089154 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105089154 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105089154 NCBI-ProteinID:  XP_031291343 LinkDB All DBs Position 20:25516844..25518057 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagacggcccgcaagtccaccggcggcaaagcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcacaatc atgcccaaggacattcagctcgcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system