KEGG   Camelus dromedarius (Arabian camel): 105102071Help
Entry
105102071         CDS       T04642                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00250  Alanine, aspartate and glutamate metabolism
cdk00410  beta-Alanine metabolism
cdk00430  Taurine and hypotaurine metabolism
cdk00650  Butanoate metabolism
cdk01100  Metabolic pathways
cdk04727  GABAergic synapse
cdk04940  Type I diabetes mellitus
Module
cdk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    105102071 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105102071 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105102071 (GAD2)
   00430 Taurine and hypotaurine metabolism
    105102071 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    105102071 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    105102071 (GAD2)
Enzymes [BR:cdk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105102071 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105102071
NCBI-ProteinID: XP_010993636
LinkDB All DBs
Position
Un
AA seq 585 aa AA seqDB search
MASPGSGFWSFRSEDGSGDPENSGTARAWCQVAQKFTGGIGNKLCALLYGEAEKPEESGG
SQPPRATSRKAACACNQKPCSCPKADVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPLSLRVLDDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcccggctccggcttctggtccttcagatctgaagatggctccggggatccc
gagaactccggcacagcgagagcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgcgccctgctctacggagaggcggagaagccagaggagagcggtggg
agccagcccccgcgggccacctcccggaaggccgcctgcgcctgcaaccagaagccctgc
agctgccccaaagcggatgtcaactatgcgtttctacacgcaacagacctgctaccagcg
tgtgatggagaaaggcccactttggcgtttctgcaagatgttatggacattttgcttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttcttcaagaatataattgggagttggcagaccaaccacagaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcccaggtatttcaat
caactttctactggactggatatggttggattagcagcagactggctgacatcaacagca
aacacgaacatgttcacctatgaaattgctcctgtctttgtgcttttggaatatgtcacg
ctaaagaagatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cctggtggcgccatatctaacatgtacgccatgctcatcgcgcgctttaagatgttcccg
gaagtcaaggagaaaggaatggcggctgtccccaggctcatcgccttcacatctgagcat
agtcatttttccctcaagaagggagctgcagccttgggcattggaacagacagcgtgatt
ctgattaaatgtgatgaaagggggaaaatgattccatccgatcttgaaagaaggatcctt
gaagtcaaacaaaaagggtttgtccctttccttgtgagtgccacggctgggaccaccgtg
tatggagccttcgatcccctcttagctgttgccgacatctgcaaaaagtacaagatctgg
atgcacgtggatgcagcttggggtgggggattactgatgtcccggaagcacaagtggaag
ctgaacggcgtggagagggccaactctgtgacgtggaatccgcataagatgatgggcgtc
cctctgcagtgctctgctctcctggtcagagaagagggactgatgcaaagttgcaaccag
atgcatgcctcctacctctttcagcaagataaacactacgacctgtcctacgacaccgga
gacaaggccttacagtgtggacgccacgtcgatgtttttaagctctggctcatgtggagg
gcaaaggggacaactgggtttgaagcacacattgataagtgtttggagctggcagagtat
ttatacaacatcatcaaaaaccgagaaggatatgaaatggtgtttgatggaaagcctcag
cacacaaacgtctgcttctggtatgtgcctctgagtctgcgggtcctggacgacaacgaa
gagagaatgagccgcctctccaaggtggctccagtgattaaagccagaatgatggagtac
gggaccacaatggtgagctaccagcccttgggagacaaggtcaatttcttccgcatggtc
atctcaaaccctgcagccactcaccaagacattgacttcctgattgaagaaatagaacgc
cttgggcaagatttataa

DBGET integrated database retrieval system