KEGG   Camelus dromedarius (Arabian camel): 105102547Help
Entry
105102547         CDS       T04642                                 

Gene name
KMT5A, SETD8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105102547 (KMT5A)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105102547 (KMT5A)
Chromosome [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105102547 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 315 aa AA seqDB search
MGLAGLQENVFTGQSKIYTYMSPNKCSGMRSPLQEENSVAHHEVKCQGKPLSGIYRKRDE
KRNSGNAMRSTMKADEHKIKDARRGPLAPFPNQKSEAAEPPKTPTSSCDSPNAAAAKQAL
KKPVRGKQTPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEG
MKIDLIDGKGRGVIATKQFSRGEFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQY
LSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIGGVPHLILIASRDIEAGEELLYDYG
DRSRASIEAYPWLKH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggccgggctgcaggagaacgtgtttaccgggcaatcaaagatctatacctac
atgagcccgaacaaatgctctggaatgcgttccccccttcaggaagagaactcagttgca
catcacgaggtcaaatgccaggggaagccattatccggcatctacaggaaacgcgacgag
aaaagaaactctgggaacgccatgcgaagcaccatgaaggccgatgaacacaagatcaaa
gacgccaggaggggtcccctggcaccttttccaaaccaaaaatctgaagctgcagaacct
cccaaaaccccaacctcgtcttgtgattctcccaatgcagccgccgccaagcaagccctg
aaaaagcctgtcaggggcaaacagacacccaggaaaaaagctcaaggaaaaacgcaacag
aatcgcaaactcacagatttctatccagtgcgaaggagctccaggaagagcaaagctgag
ctgcagtctgaagaaaggaaaagaatagatgagctgattgaaagcgggaaggaagaagga
atgaagattgacctcatcgatggcaaaggcaggggcgtgattgccaccaagcagttctcc
cggggcgagtttgtggtggaataccacggggacctcattgagatcaccgacgccaagaag
cgggaggctctttacgcacaagacccctccacgggctgctacatgtactattttcagtat
ctgagcaaaacctactgcgtggatgcgactagagagacaaaccgcctggggaggctgatc
aatcacagtaaatgcgggaactgccagaccaagctgcacgacatcggcggcgtgcctcac
ctcatcctcattgcctcccgcgacatcgaggccggggaggagctcctgtacgactatggg
gaccgcagcagggcttccatcgaagcctacccctggctgaagcattag

DBGET integrated database retrieval system