KEGG   Clostridioides difficile R20291: CDR20291_0051Help
Entry
CDR20291_0051     CDS       T00998                                 

Definition
(GenBank) elongation factor TU
  KO
K02358  elongation factor Tu
Organism
cdl  Clostridioides difficile R20291
Brite
Translation factors [BR:cdl03012]
 Eukaryotic Type
  Elongation factors
   CDR20291_0051
 Prokaryotic Type
   CDR20291_0051
Mitochondrial biogenesis [BR:cdl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CDR20291_0051
Exosome [BR:cdl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CDR20291_0051
  Exosomal proteins of breast cancer cells
   CDR20291_0051
  Exosomal proteins of colorectal cancer cells
   CDR20291_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CBE01552
UniProt: C9YHL0
LinkDB All DBs
Position
87476..88669
Genome map
AA seq 397 aa AA seqDB search
MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEAVDFANIDKAPEERER
GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSATDGPMPQTREH
ILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYDFPGDDTPIVRGSALMAL
EDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFSITGRGTVATGRVERGVLK
VQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLAKTG
SVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGACKLPEGIEMVMPGDNV
TMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctaaatacgaaagaacaaaacctcatgttaatatagggacaataggacac
gtagaccacggtaaaactacattaacagcagcaataacaaaaacattatatgacagatat
caattaggagaagcagtagatttcgcaaacatagataaagctccagaagaaagagaaaga
ggaatcacaatatcaacagcacacgttgagtatgaaacaccaaatagacactatgcacac
gttgactgcccaggacatgctgactacgttaagaacatgataacaggagcagcacaaatg
gacggagcaatattagtttgttcagcaacagatggaccaatgccacaaacaagagagcat
atactattatcaagacaagttggagtaccatatatagtagtattcttaaacaaatgtgac
atggtagatgatgaagagttattagagttagtagagatggaagtaagagatttattaaca
gaatatgatttcccaggagatgacactccaatagtaagaggttcagcattaatggcatta
gaagatccaaagagcgagtggggagataagatagtagaattattcgagcaaatagatgag
tatataccagctccagagagagatacagataagccattcttaatgccagtagaggatgta
ttctcaatcacaggaagaggaacagttgcaacaggaagagtggaaagaggagtactaaaa
gtacaagacgaagtagaattagtaggattaacagaagcaccaagaaaagtagtagtaaca
ggagtagagatgttcagaaaattattagaccaagcacaagcaggggataatataggagca
ttattaagaggagtacaaagaaacgagatagaaagaggacaagtactagcaaagactgga
tcagtaaaggcacacacaaagtttacagcagaagtatatgtacttaaaaaagaagagggt
ggaagacatacaccattctttgatggatatagaccacaattctatttcagaacaacagac
gtaacaggagcttgtaagttaccagaaggaatagagatggtaatgcctggagataacgta
acaatggaagtagacttaataaactcaatagttgtagaagagggattaagattctcaata
agagaaggtggaagaacagtagcttcaggagttgttgctacaataatagagtaa

DBGET integrated database retrieval system