KEGG   Corynebacterium diphtheriae 241: CD241_0480Help
Entry
CD241_0480        CDS       T01687                                 

Gene name
nanH
Definition
(GenBank) sialidase-1
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CD241_0480 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CD241_0480 (nanH)
Enzymes [BR:cdp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CD241_0480 (nanH)
Bacterial toxins [BR:cdp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CD241_0480 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
471076..473250
Genome map
AA seq 724 aa AA seqDB search
MYSSNRTYSRAILGLSAALALSFTSLAVPANAQESETALPATAELNGKESAALLSAETGL
FDAAPPKPVARGAAGNLQLPAVNEEEVFEEGRVIRAPEPDQSRCYRIPALVTAQNGDLLL
AFDNRYGGGDGAKTWCRDAPYENMKRINRQNMQTDIQLYRSVDNGQSFEDFGYIAQGTAD
VRELSYTDPALVTDRTTGKIFAFFVRAYDYRVGQSSAGFNEGDVEAEIQKRDVQDTVVVE
SLDGGQTWGNMRLLSALTAKVSSISTGDTIFDGRGRFVTSGAGIQLQYGEHAGRLIVPIS
VDIDPKDSAKFINLAIYSDDHGQTWQAGIGTAGGAGFSGDESKIVELSDGRLMMSSKDND
KPRWVSYSEDQGENWSTPKRKIIAPPQHPEKHNTGINVGLIRAYPNAPENSAAARVLLYS
APIDQRYSHKHTEDGRNNGWVMGSCDDGKTWSFGRQIEKNRFQYSSMTVMSDGNIGMVYE
SGDFSTGMNLKFAKFNMAWLGADCLSNEALGLTGDIDKEIVAAQEKAAAATKEAQEAAEK
VEKLTEELAAARKENDELKTQVKESEEAVGDLADKVFKLENAVTEAKKKATVAEKAVSDA
LAKLQEAESIAEEQKAKAESAAAEAQALREKLEKVEGSILIVKENSEAEESADLSSTVKD
AADTARRAATDANGALSGQKQNEEKPAMGLMRILKVLAGIIPLVAIIATIFQTFHLPFNI
PGMR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgtattcctcaaaccgaacctatagccgggcgattctcggcctcagcgcggcactagcg
ctttcgttcacatcactcgctgtgccggcaaatgcacaagaatcggaaaccgctttgccg
gcaaccgcagagttaaatggaaaagagtccgcggcattgctgagcgctgaaactggtctt
tttgatgccgcaccaccaaagcctgtggctcgtggtgcagcaggaaacttgcaattacca
gcagtgaatgaagaagaggtatttgaggaagggcgagtaattagggcgccggaacctgat
cagagtcgatgctatcgaattccggcattagtgactgcgcagaacggtgaccttcttctt
gcctttgataatcgatatggtggtggagatggcgctaagacttggtgtagggatgcgccc
tatgagaatatgaagcgaattaacaggcagaatatgcaaaccgatatacagttgtatcgc
tctgttgataatggacaatcttttgaagattttggatatatagctcaggggacagctgac
gtaagggagttgtcctatacggatcctgcattggttactgatagaacaactggaaaaatt
tttgctttctttgttcgggcgtacgactatcgtgtgggtcaatcttcggcaggttttaat
gagggggacgttgaggccgagattcaaaaacgtgatgtgcaagatacggttgtggtggaa
tctttggatggggggcagacttgggggaatatgcgtcttcttagtgcattaactgcaaaa
gttagtagcatttctacgggggatactatttttgatggacgcggtagattcgtaacatcg
ggtgcgggtattcagttgcaatatggggagcacgctggaaggttgatagttccgatatcg
gtggatattgatccgaaggattcggccaagtttattaatctggccatctattccgatgat
catggacagacatggcaggcaggtataggaactgctggtggagcaggattttcgggcgat
gaaagtaaaatagtcgagttatctgatggtcgcttgatgatgagctcgaaagataatgat
aaacctcgctgggtctcctattctgaagaccaaggtgagaattggtctacgcctaagcgt
aaaataattgcacctccacagcatccggaaaagcacaacacgggaataaatgtggggctg
attcgggcttatcctaatgctccggaaaatagtgccgcggcgcgagtactgctgtattcc
gctcctatcgatcagcgttattctcataagcatactgaggatggtcgtaataatggctgg
gtcatgggatcttgtgatgatggaaagacatggtcctttggtcgccaaattgaaaagaac
cgtttccagtattcaagcatgacagttatgtctgatggcaacatcggcatggtgtacgag
agtggagactttagtaccggaatgaacctgaaatttgccaagttcaacatggcatggcta
ggtgcggattgtcttagcaatgaggcattgggtttgacaggcgatattgataaggaaatc
gtcgcggcgcaagaaaaggctgctgctgcgactaaagaagctcaagaagctgcggagaag
gttgaaaagttaactgaagagttggctgctgctcgtaaagaaaatgacgagctcaagact
caggtaaaggaatctgaggaagccgttggggatctagctgacaaggtatttaagctagag
aacgccgtcacggaagcaaaaaagaaagctactgtagctgaaaaggcagtatccgacgct
ctcgctaaactgcaagaagctgagtcgattgcggaagagcaaaaggctaaagctgaatct
gcagccgcagaagctcaggcattgcgtgaaaagctggagaaagttgaaggaagcattctt
attgtgaaggagaattcagaagcagaagaaagcgctgatctatcaagtacagtgaaggat
gctgctgatacggctcgtcgcgctgctacggatgcaaacggtgcactttctggccaaaag
caaaatgaagaaaagccagctatgggcttgatgagaatcttgaaagtgcttgcggggatc
attccactggtagcgatcattgcgactatattccaaacattccatttgccttttaacatt
cctggaatgaggtag

DBGET integrated database retrieval system