KEGG   Corynebacterium diphtheriae HC03: CDHC03_0492Help
Entry
CDHC03_0492       CDS       T01695                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDHC03_0492 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CDHC03_0492 (alr)
Enzymes [BR:cdr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CDHC03_0492 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cdr01011]
 Precursor biosynthesis
  Racemase
   CDHC03_0492 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
496456..497604
Genome map
AA seq 382 aa AA seqDB search
MNLLETRISCEAIAANTRRLKDMVAPAQLMCVVKADGYNHGAPEVATVMARNGADQFGVA
TLAEAHQLRDAGITLPILCWIWSPEQDFSAAIDRDIDLAAVSMEHVRALITEAMRRPAGT
RVRVTVKIDTELHRSGIDEANWTEAFELLHACPQINVTGVFSHLACADDLESDYTDHQAE
VFRRAIDAGRRVGLDLPVNHLAASPATLTRPDLHFDMVRPGLALYGHEPIAGLDHGLREA
MTWIGSVTVVKPIAAGQGTSYNMTWHAPADGYLCVVPVGYADGLPRNVQGHLEVTIAGTR
YPQVGRVCMDQIVVFLGDNSRGVAPGDEAIIFGPRDTQAMTATELACATGTINYEILCRP
TGRSHRTYSDLDAVAPTHPTES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgaaactcgcatctcgtgcgaagccattgctgcgaacacgcgacgttta
aaagacatggttgctcccgctcagctcatgtgtgttgtaaaagctgacggctacaatcac
ggtgccccagaagttgctactgtgatggcgcgtaacggtgccgaccaatttggtgtcgca
acgcttgcggaagcacatcagctacgagacgcgggtattaccctccccatcctgtgctgg
atctggtcacccgagcaggacttttccgccgccattgaccgtgacatcgacttagccgcc
gtcagcatggaacacgttcgtgcactgatcacagaggctatgcgtcgtcccgcaggtacc
cgagtgcgggtgaccgtgaaaattgacacggaacttcaccgatctggaatcgacgaagca
aactggacagaagcctttgagctgcttcatgcctgcccccaaatcaacgtcacgggcgta
tttagtcacttggcatgcgcagacgacttggaatcggactacaccgaccaccaagcagaa
gtattccgcagggcgattgatgcaggtagacgcgtaggacttgaccttcctgttaatcat
ctagcggcatcaccagcaacactaacccgccccgacttgcactttgacatggtccggcct
gggcttgccctctatggtcacgaaccgatagcaggactcgaccacgggctgcgcgaagcc
atgacatggattggttcagtaacagtggtcaaacccatcgcggcaggccaaggaaccagc
tacaacatgacatggcatgcgcccgcagatggctacctctgcgtggtgccggttggttat
gcggacggattaccgcgcaacgtacaaggacatttagaagtaacgatcgccggcacgcgc
tacccacaagtaggccgtgtttgtatggaccagattgtggtattccttggcgataattcc
cgcggtgttgcccctggtgatgaggcaattatttttggcccaagagatacccaagcgatg
acagcgacggagctggcctgcgctacgggaaccatcaactatgaaatcttgtgccgcccg
accggacgaagccatagaacctatagtgatcttgacgccgttgcgcccacgcaccctact
gaaagctga

DBGET integrated database retrieval system