KEGG   Corynebacterium diphtheriae VA01: CDVA01_0454Help
Entry
CDVA01_0454       CDS       T01702                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDVA01_0454 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CDVA01_0454 (alr)
Enzymes [BR:cdv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CDVA01_0454 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cdv01011]
 Precursor biosynthesis
  Racemase
   CDVA01_0454 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
473705..474853
Genome map
AA seq 382 aa AA seqDB search
MNLLETRISCEAIAANTRRLKDMVAPAQLMCVVKADGYNHGAPEVATVMARNGADQFGVA
TLAEAHQLRDAGITLPILCWIWSPEQDFSAAIDRDIDLAAVSMEHVRALIAEAMRRPAGT
RVRVTVKIDTELHRSGIDEANWTEAFELLHACPQINVTGVFSHLACADDLESDYTDHQAE
VFRRAIDAGRRVGLDLSVNHLAASPATLTRPDLHFDMVRPGLALYGHEPIAGLDHGLREA
MTWIGSVTVVKPIAAGQGTSYNMTWHAPADGYLCVVPVGYADGLPRNVQGHLEVTIAGTR
YPQVGRVCMDQIVVFLGDNSRGVAPGDEAIIFGPRDTQAMTVTELACATGTINYEILCRP
TGRSHRTYSALDAVAPTHPTES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgaaactcgcatctcgtgcgaagccattgctgcgaacacgcgacgttta
aaagacatggttgctcccgctcagctcatgtgtgttgtaaaagctgacggctacaatcac
ggtgccccagaagttgctactgtgatggcgcgtaacggtgccgaccaatttggtgtggca
acgcttgcggaagcacatcagctacgagacgcgggtattaccctccccatcctgtgctgg
atctggtcacccgagcaggacttttccgccgccattgaccgtgacatcgacttagccgcc
gtcagcatggaacacgttcgtgcactgatcgcggaggctatgcgtcgtcccgcaggtacc
cgagtgcgggtgaccgtgaaaattgacacggaacttcaccgatctggaatcgacgaagca
aactggacagaagcctttgagctgcttcatgcctgcccccaaatcaacgtcacgggcgta
tttagtcacttggcatgcgcagacgacttggaatcggactacaccgaccaccaagcagaa
gtattccgcagggcgattgatgcaggtagacgcgtaggacttgacctttctgttaatcat
ctagcggcatcaccagcaacactaacccgccccgacttgcactttgacatggtccggcct
gggcttgccctctatggtcacgaaccgatagcaggactcgaccacgggctgcgcgaagcc
atgacatggataggttcagtaacagtggtcaaacccatcgcggcaggccaaggaaccagc
tacaacatgacatggcatgcgcccgcagatggctacctctgcgtggtgccggttggttat
gcggacggattaccgcgcaacgtacaaggacatttagaagtaacgatcgccggcacgcgc
tacccacaagtaggccgtgtttgtatggaccagattgtggtattccttggcgataattcc
cgcggtgttgcccctggtgatgaggcaattatttttggcccaagagatacccaagcgatg
accgtcacggagctggcctgcgctacgggaaccatcaactatgaaatcttgtgccgcccg
accggacgaagccatagaacctatagtgctcttgacgccgttgcgcccacgcaccctact
gaaagctga

DBGET integrated database retrieval system