KEGG   Corynebacterium diphtheriae PW8: CDPW8_1100Help
Entry
CDPW8_1100        CDS       T01701                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00620  Pyruvate metabolism
cdw00680  Methane metabolism
cdw01100  Metabolic pathways
cdw01120  Microbial metabolism in diverse environments
cdw01200  Carbon metabolism
Module
cdw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDPW8_1100 (ppc)
  Energy metabolism
   00680 Methane metabolism
    CDPW8_1100 (ppc)
Enzymes [BR:cdw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CDPW8_1100 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC
Motif
Other DBs
NCBI-ProteinID: AEX69755
LinkDB All DBs
Position
1122447..1125200
Genome map
AA seq 917 aa AA seqDB search
MGTLCIHHFCRKAELVTAAISDRVREDIRLLGRVLGRVIAQQEGEEVYELVEATRRMAFD
VSHGDADPEDLMVIFRDLDITKTNLVARAFSYFALLANLVEDLDDESVEADVSLRKTFAK
LKREGVSAADAASVIRSAEVAPVLTAHPTETRRRTVFDTQTRIKQLLKDAHHGGDMQVIE
QEMYLRMTLLWQTALIRIARPTLEDEIDVGLRYYKKSLLEQVPALNRSIRHSMRETFGLQ
LPDIAVMRPGSWIGGDHDGNPYVNARTLTYATRQAAKTVARYYVEQLGELERELSLSDRY
SSCSKELLALAEASGNNWESRVDEPYRRAVYGMRARMKSNVDALERPEKTAGKKSSKRTP
YATPEEFLRDLDVIDRSLRAHNDDVIADDRLARIRSAVTTFGFHLYTLDIRQNSESFEAV
IEEVFAAARRVPGGKRYSELAEAEKVELLIQELQTPRPLLFPGALEVEDAFSADTTKELG
IFLAAAQAVRDFGSRSIAHCIISMTATVSDILEPMVLLKEVGLRDVDVVPLFETIDDLRC
GAAILRELWSHPFYREHLRARGDIQEVMLGYSDSNKDGGYLQANWALYEAELGLVELCRE
HNIELRLAHGRGGAVGRGGGPTYDAILAQPKGAVSGSVRITEQGEVISAKYGAPETARRH
LEAFVSGALEASLLDTEPIADPDRAYAIMRDLAGFSGQRYQELVGDPGFIEYFTQSTPLH
EIGELNLGSRPAARKQTTAISDLRAIPWVLSWSQSRTNIPGWFGVGSAVSRFVSAVPEKD
RESRWQELRDLYATWPFFRSVMSNMAQVMAKAEISLARLYADLVDDPEVADRIYALIAEE
FELTRRAYLAITGNEALVSENQRQARSLKRRYPYLLPLNAIQLELLRRYRGGDDQFLVSK
TIQVTMNGLATALRNAG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgggcacactttgtatccatcacttttgtaggaaggctgagctcgtgactgctgccatt
tctgatcgtgtccgtgaagatattcgattgctgggacgcgtactaggacgagttattgcg
cagcaagagggcgaagaagtctatgagctggtagaagctactagacgcatggcgtttgat
gtttctcatggtgacgctgatcctgaagatttaatggtgatttttagggatcttgatatc
actaagaccaaccttgttgctcgtgcttttagttattttgcgctgctggctaatttggtt
gaggatcttgatgatgaatccgtagaggcggatgtttcattgcgtaaaacttttgccaag
cttaagcgggagggggtgtctgcagctgatgctgcgagtgtgattcgtagtgctgaggtt
gcaccggtgcttacggcgcatcctacggagacgcgtcgtcgtacggtgtttgatactcag
actcggatcaagcagttgctcaaagacgcccatcatggtggggatatgcaggtcattgag
caggaaatgtatctgcggatgacgctcttgtggcaaaccgcgctgattcgtattgcgcgt
ccaacgctggaggatgagatcgatgtggggttgcgctattacaagaagtcactcttggag
caggttcctgcgttgaatcgttcgatccgtcattctatgagggagacgtttggtctgcag
ctgccagatattgcggtgatgcgtcctggctcgtggattggtggcgatcacgatggtaat
ccgtatgttaatgctcgtaccttgacgtacgcgacgcgtcaggccgccaagacagtggcg
cgttattacgtggagcagttgggtgaactggaacgcgagctgtcgctgtctgatcgttat
tcttcgtgctccaaggagctgcttgcgttggccgaggcttcgggtaacaactgggaatcg
cgtgttgatgagccgtatcgtcgtgcagtctatgggatgcgcgcccgtatgaagtccaat
gtggacgctttggagcgtccggagaaaacagcggggaagaagtcgtcgaaacgcacgcct
tatgcaactcctgaggagttcttgcgcgatcttgatgtgattgatcgatcattgcgtgcg
cacaatgatgatgtgatcgctgatgatcggctagcgcgtatccgctcggctgtaaccact
tttgggttccatttgtacactctcgatatccgtcagaattctgagtcttttgaggctgtg
atcgaggaggtattcgcggcagcgcgtcgtgtacccggcggtaagcgttattcggagctt
gctgaggcagaaaaggttgagctgcttatccaggagctgcaaactccgcgtccgctgttg
ttccccggcgcgcttgaggtcgaggatgcgtttagcgctgataccactaaagagttgggg
attttcttagcggcggctcaggcggtgcgggatttcggatcgcggtcaattgcgcattgc
attatttcgatgacggctacggtgtccgacattttggagcctatggtgcttttgaaggaa
gtcggattgcgtgatgttgatgtggttccgctttttgagactatcgacgatcttcgctgc
ggtgctgctattttgcgcgagctgtggtcgcatccgttttatcgtgagcatcttcgtgcc
cgtggggatatccaagaggtgatgttggggtattccgattccaacaaggacggcgggtat
ctgcaagctaactgggcgttgtatgaagctgagctgggcttggtggagttgtgccgtgag
cacaatattgagttgcgtttggctcatggccgtggtggcgctgtgggccgtggtggtgga
cctacttacgatgcgattttggcgcagccgaagggtgcggtgtcgggttctgttcgtatt
acggagcagggcgaggtgatttctgcgaagtatggtgcgcctgagacggcgcgccgtcac
ttggaggcgtttgtttcgggggcgttggaggcgtcgcttctcgatactgagccgattgcg
gatccggatcgtgcgtatgcgattatgcgtgatcttgctggctttagtggtcagaggtat
caggagttggtgggagatcctgggtttattgagtacttcacgcagtcgactccattgcat
gagattggtgagcttaatctggggtcgcgtcctgctgcgcgtaagcaaacgacagctatt
tcagatcttcgtgctattccgtgggtgttgtcgtggtcgcagtcgcggaccaatattcct
ggttggtttggtgttggtagcgcggtgagccgttttgtatcggcggtgccggagaaggac
cgagagtcacggtggcaggagctgcgtgatttgtatgcaacgtggccatttttccgctcg
gtgatgtcaaatatggctcaggttatggccaaggcagagatctcgctggcaaggttgtat
gccgatttggtggatgatcccgaggttgctgaccggatttatgcgttgattgcagaagaa
tttgaacttacgcgtcgtgcatatttggctattactggtaatgaggcactggtgtcggaa
aaccagcgccaagcccgttcacttaagcggcgttacccgtatttgctaccgcttaacgcc
attcagctggagttgctgcggcgttatcgtggtggcgatgatcaattcttggtgtctaag
actattcaggtcaccatgaatggtttggccactgcgttgcgtaatgcggggtag

DBGET integrated database retrieval system