KEGG   Corynebacterium diphtheriae 31A: CD31A_0540Help
Entry
CD31A_0540        CDS       T01697                                 

Gene name
nanH
Definition
(GenBank) sialidase-1
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CD31A_0540 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CD31A_0540 (nanH)
Enzymes [BR:cdz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CD31A_0540 (nanH)
Bacterial toxins [BR:cdz02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CD31A_0540 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
538596..540719
Genome map
AA seq 707 aa AA seqDB search
MQKPKHAIGRTLLGLTAAVSLTAQTLGTPVLAQEKLDQGTVQSPSIIPGGPEVGLFDAAP
PSEPVLGAAGGVGLPEAQSEEIFETQMLHDVDPNNVRCVRIPAIATAADGSVLVAFDDRY
GPGTNCADAPYRPGNNRDPRWQTDIEIYRSTNSGQSFKKAGFIAKGTEDPRGLSYTDPSL
VVDRNTGKIFAFFVRGYDRRVAQAEHGFHDGDPKAELTNRNVQDTIVIESNDNGNSWTNM
RLISKLTDEVTVKGQKLKGYGRFVTSGSGIQLRYGEKAGRLIVPIAVDVDGSERAKFVNL
AIYSDDGGDEWKIGEGVGGTGYYNGDENKLVELSDGRIMMNSRENGRKRWTSYSVDQGLT
WTDPVQTVFAPPQEPTSYNEGINVGLIRAYPNAPQGSAAAKVLLFSAPISHRIESDDGRH
NGWVMASCDDGQSWKYGKQIERGKFQYSVMTPMEDGTIGMVYETADPGRAGVLKFAKFNM
AWLGADCLSEKTTGIAPKLDPKVVAKAEEAAKAALKADAKVQELVDKLGASMANGVMMRQ
ELADAEADAAKAHAAAEEAKAAVAQAEEAMRAAVEELQVQLDSMKEQAVNTESEMAEQTA
ALEKAQQQLKEAGEKNAELQAKLQEVETQLAESREEAAALAQQAKEQSKVVKDVTEQVVK
DVPGDKENVAVPTEKKGFSWASLIGLLGMGLPILVAIFNAVRQFLHI
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaaccaaagcatgccatcgggcgcactctgctcggactcactgctgcagtttca
ctaacagcccagacgctgggtacacctgtgctcgcacaagaaaagctagatcaaggaacc
gttcagagcccctcaatcattccgggcggtccagaagttggtcttttcgacgcagcacca
ccatcggaaccggtgctcggtgcagctggtggggtgggtttgccggaggctcagagtgaa
gaaatctttgagacacagatgttacatgatgtggaccccaacaatgttcgatgtgtgagg
attccggcgattgccaccgctgcagatgggtcggtgctagttgcgtttgatgaccgttat
ggcccaggaactaactgcgcggatgctccgtatcgccccggaaataacagagatccacga
tggcagacggacattgaaatctatcgttcaacgaacagtggtcaaagctttaagaaagcc
ggatttatcgcaaagggaacggaggatccgcgaggtctctcctacacggacccatcgcta
gttgttgatcgaaatactgggaaaatttttgcgttttttgtccgaggttatgatcgcagg
gtggcgcaggcagagcatggttttcatgatggtgatcccaaagctgaattaaccaatcgc
aatgttcaagacaccattgttattgagtcgaatgataatggaaatagttggacgaacatg
cgattgattagcaagctaactgacgaagtaactgttaaggggcaaaagcttaagggctac
ggccgctttgttacatcaggatctggtattcagttgcgttatggtgaaaaagcgggaagg
cttatcgttcccatcgctgtggacgttgatggatctgagcgtgcaaagtttgtcaatctt
gctatttattccgatgatggcggggatgaatggaagatcggcgaaggtgtgggcggaacg
ggttactataacggtgacgaaaacaagctcgttgagctatctgatggccggattatgatg
aattcccgcgaaaatgggcgcaaacgatggacatcttattctgtcgatcaaggtttgaca
tggactgatcctgtacaaacagtatttgcgccaccacaggaacctactagctacaacgaa
ggaattaacgttgggctaatccgagcttatccgaatgctccgcagggaagtgctgctgca
aaagttttgttgttctcggcgccaatctcgcatcgaatcgagagtgatgatggtaggcat
aacggttgggtaatggcttcttgcgatgacggacaaagttggaagtacggtaagcagatc
gaacgcgggaaattccaatactcagtgatgactccgatggaagatggcaccattggaatg
gtttacgagaccgcagatccaggtagggcaggtgttctgaaatttgccaagttcaatatg
gcttggctgggggcagactgcctaagtgaaaagaccactggtattgcgccgaagcttgat
ccaaaggttgtggctaaggctgaggaagcagctaaggctgcgctgaaggcagatgctaag
gttcaggagctcgtcgataagcttggtgcttcgatggcaaatggtgtgatgatgcgtcag
gaattggccgatgctgaggcggacgctgccaaggcacatgccgctgctgaagaagcaaaa
gctgctgttgcgcaggcggaagaagccatgcgggctgccgtcgaggagttgcaagtgcag
ctcgacagtatgaaagaacaagccgtaaataccgaaagcgagatggcagaacagactgcg
gcactggaaaaagcacagcaacagctgaaagaagctggtgaaaagaatgccgaattgcag
gcaaagcttcaagaggttgaaacccagctggcggagtcccgtgaagaagctgcagcacta
gcgcaacaagccaaagagcaatcgaaggtcgttaaagatgtaaccgagcaggtagtaaaa
gacgttccaggtgacaaggagaatgttgccgttccaactgaaaagaagggcttctcttgg
gcatctctcatcggactgctcggaatgggactgccaattttggtcgcgatcttcaatgcg
gtccgtcagttcctccatatataa

DBGET integrated database retrieval system