KEGG   Cedecea neteri: LH89_00325Help
Entry
LH89_00325        CDS       T03347                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ced  Cedecea neteri
Pathway
ced00250  Alanine, aspartate and glutamate metabolism
ced00410  beta-Alanine metabolism
ced00640  Propanoate metabolism
ced00650  Butanoate metabolism
ced01100  Metabolic pathways
ced01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ced00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LH89_00325
   00650 Butanoate metabolism
    LH89_00325
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH89_00325
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH89_00325
Enzymes [BR:ced01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LH89_00325
Amino acid related enzymes [BR:ced01007]
 Aminotransferase (transaminase)
  Class III
   LH89_00325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIR67720
LinkDB All DBs
Position
67987..69252
Genome map
AA seq 421 aa AA seqDB search
MSNSELNQRRLAATPRGVGVMCDFFADKAENATLWDVEGREYIDFAAGIAVLNTGHRHPK
LVAAVREQLEKFTHTAYQIVPYGSYVTLAERLNALAPIAGPAKTAFFTTGAEAVENAVKI
ARAYTKRPGVIAFGAAFHGRTLLTLTLTGKVAPYSTGFGPFPGSIFHALYPNAQHGITVE
QALESIDRLLHTDIAADQVAAILLEPVQGEGGFNVAPPEFISGVRQLCDKYGMLLIADEV
QTGFARTGKVFAMEYYDDKADLITMAKSLGGGFPISGVVGRAEVMDAPGPGGLGGTYAGN
PLAVASALAVLDVIEEEQLCQRAQRLGATLVEALERAKAGNAAIADIRARGSMVAVEFND
PQTGKPSAEITKKYQQAALEQGLLLLTCGTHGNVIRFLYPLTIPDTQFSKALSILSSVLA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagcgaattgaatcaacgtcgtttggccgccacgccgcgtggcgtgggcgtc
atgtgcgatttctttgccgacaaggccgaaaacgccaccctgtgggatgttgaagggcgc
gagtatattgattttgctgccgggattgcggtgctgaacaccggccaccgtcacccgaaa
ctggtggcggcggtgcgtgaacaactggagaaattcacccataccgcgtatcaaatcgtc
ccctacggcagctatgtgacgttggcggaacgcctgaacgcgctggcgccgatcgccggc
ccggccaagactgctttcttcaccacgggcgccgaagcggttgaaaatgcggtgaaaatc
gcccgcgcttataccaaacgtccgggcgtgatcgcgtttggcgcggcgttccacggccgt
acgctgctgaccctgacgctgaccggtaaagtggcgccgtattccaccggattcggcccg
ttcccgggatccattttccacgcgctgtacccgaatgcccagcatggcatcaccgtggaa
caggcgctggagagcattgaccgcctgctgcacaccgatatcgccgccgatcaggtcgcg
gccattctgctggagccggtacagggcgagggcggcttcaacgtcgcgccgccggaattc
atcagcggcgtgcgccagctgtgcgacaagtacggcatgctgctgatcgccgatgaagtg
cagaccggctttgcccgtaccggcaaagtgttcgctatggaatattacgacgataaagcg
gacctgatcaccatggcgaaaagcctgggcggcggtttcccgatttccggcgtggtgggt
cgtgccgaggtgatggacgcgccgggccccggcgggctgggcggtacttatgccggtaac
ccgctggcggtggcgtcggcgctggcggtgctggatgtgattgaagaagaacagttgtgt
cagcgcgcccagcgcctgggcgctacactggtagaagcgctggagcgggcgaaagccggc
aatgcggccatcgccgatattcgcgcccgcggctcaatggtggcggtggagtttaacgat
ccgcagaccggcaaaccgagcgcggagatcaccaaaaaataccagcaggcggcgctggaa
cagggactgctgctgttgacctgcggcacgcacggcaacgtgattcgtttcctgtatcca
ctgaccattccggatacccagttcagcaaggcgctgtcgattctgagcagcgttctggcg
aaataa

DBGET integrated database retrieval system