KEGG   Caenorhabditis elegans (nematode): CELE_C10E2.3Help
Entry
CELE_C10E2.3      CDS       T00019                                 

Gene name
hda-4
Definition
(RefSeq) Histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CELE_C10E2.3 (hda-4)
Chromosome [BR:cel03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     CELE_C10E2.3 (hda-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
UniProt: 
LinkDB All DBs
Position
X:join(16729563..16729703,16739817..16740015,16740577..16740700,16740789..16741193,16741240..16741385,16741438..16741545,16741726..16742369,16742413..16742583,16742628..16743071,16743487..16743579,16743625..16743759)
Genome map
AA seq 869 aa AA seqDB search
MEEASSSTGSAGGAGPSVPNLPSTSEAAIGQTNLEPESIALLQSQLQEYRQKQMDLIGHF
QRAQQELSVQHMHNLYAALQQQQQLQNLQTERSAVNPLLISQQHSTEDQNSGPAAPLSLA
NSLTNLLSSSNGNLSVPQTPTKEHHPTAPTSNRKCDLPRSNSTTISQLTKDRLKNMIANR
SKGESNSQSNLMSNSVTANGNGHDNGRKLKNSNSQVNVSSPHFEPYRLPTSLANAHNLQQ
ASEFQLRKVNSEPNLKMRIRAKLLSKGSSPVQHVQQNNSQFNFTHPQLKRSDSETSQNVP
LDFMQSSSQTNLPHLMLPSPSLPNLAAAGAFHGLNLPVGQDLNAFMAVANLSPFLSLPSL
LNKKLELGGLTDEGDRNGLIGSSSTSSLASNVSMGSHQYQSLLKQQIRDLVLRRKSLVRE
DPEGEGLAELYNGLLPQAKLQQLQALAAESGFLAKQEPTCTTGLGYDQAMVRHECCCGNN
ASHVENGGRIQSIWSKLIEHGHVQKCEKVTAKKASLEQLQLVHSQTYTTFFAVSPTACLK
IDANSLPLKRFLQLPCGGIGVDSDTYFNDASTQTAARLAAGTLIELSSQVAEGRLKNGFA
CIRPPGHHAEHEQAMGFCFFNNVAVAVKVLQTKYPAQCAKIAIIDWDVHHGNGTQLSFEN
DPNVLYMSLHRHDKGNFFPGTGSVTEVGKNDAKGLTVNVPFSGDVMRDPEYLAAWRTVIE
PVMASFCPDFIIVSAGFDACHGHPNALGGYEVTPEMFGYMTKSLLNYASGKVVLALEGGY
DLKSISEAAQQCVQALIGESDDAGRLSSVALESLPNPSAVETLQKVIAIHKSYWPALHGQ
EAAINTTEMQWRNLKLQVQMQQQQQQQQT
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagccagctcctcaacggggagcgctggtggggctggaccaagtgttcccaac
ttgccatcaacatcagaagctgccataggacagacgaatcttgagccggaaagtattgct
cttcttcaatcacagcttcaggagtatcggcagaagcaaatggaccttattggtcacttt
caacgcgctcagcaagagctgagcgtccaacacatgcacaatttatatgctgcgttgcaa
caacaacagcagttgcagaacttgcaaaccgagaggagcgccgtcaatcccttgttgatt
agccagcagcattcgacagaggatcaaaactcaggcccagctgccccattatcactggcg
aattccctcacaaatctcctctcctcatccaacggcaatttatccgtaccacagacgccg
acaaaagagcaccacccgacggcgccaacatcaaatcgaaaatgtgaccttccgagatca
aactcaaccacaatttcacagctcaccaaagatcggctcaaaaatatgattgccaacagg
agtaaaggggagagtaacagtcagtcaaacttgatgtccaacagtgtcactgccaatgga
aatgggcatgacaatggcagaaagctcaaaaactcaaactcacaagtcaacgtctcctcg
ccacactttgaaccctaccggttaccgacgagcctggccaatgcgcacaatttgcaacaa
gccagcgagtttcaactcagaaaagttaattcagagccaaatcttaaaatgcgaatacgt
gccaaactattgtcaaaaggaagtagtcctgttcaacacgtgcaacaaaacaactcacag
ttcaatttcacacatcctcaacttaaaagaagtgacagcgaaacttctcaaaatgtgcca
ctcgactttatgcaatctagttctcaaaccaatctaccacatctcatgctgccatcaccg
tccctgccaaatctagccgccgccggcgcgttccatggtcttaatcttccagttggacag
gatctcaatgcttttatggctgtggctaatctcagcccatttctcagtcttcccagtttg
ttgaacaagaaattagagctcggcggattgacggatgaaggtgaccgaaacggactgatt
ggctcatcctccacatcatctctagcttcaaacgttagcatgggatctcaccagtatcaa
tcactgctcaagcaacaaatccgcgaccttgtgctccggcgaaaaagccttgtgagagaa
gatccagaaggcgaagggcttgccgaactctacaatggcctccttccacaggccaaactc
caacaacttcaagcgcttgcagctgaatccggatttctggcaaaacaagagcccacgtgt
acaactggattaggatacgaccaggcaatggtgagacacgagtgttgttgcggaaataat
gcgtctcacgtggagaacggaggccgaatacaaagcatttggtcaaagctcatcgagcac
ggacacgttcaaaagtgtgagaaagtaacagccaagaaggcttctctggagcaattgcag
ctggtgcactctcaaacgtacaccacattcttcgcggtttccccgacggcgtgtctcaaa
attgatgcaaactcattaccgttaaagcgattccttcaacttccgtgtggaggaatcggg
gttgattcagacacttatttcaacgacgccagtactcaaactgctgcgagattagctgct
ggaacgcttattgagctttcgtctcaggttgccgaaggacgactgaaaaatggatttgcg
tgtattcggccgccaggtcatcatgcagaacatgaacaagctatgggcttctgcttcttc
aataatgttgctgttgctgtgaaagtcttacagacgaagtacccagcacaatgtgccaaa
attgctattattgactgggatgttcaccatggtaacggaacccaactaagttttgaaaat
gatcccaatgtactctacatgtcactacatcgtcatgacaagggaaactttttccctgga
accggatctgtgaccgaagtcggaaagaacgacgcaaaaggactgactgtaaatgtgcca
ttctccggagatgtgatgcgagacccagagtacttggccgcgtggagaaccgttattgag
ccagtaatggctagtttttgcccagattttatcattgtgtcagccggatttgatgcttgc
cacggacacccgaacgcacttggcggatatgaagtcacaccggaaatgtttggatatatg
acaaaatcgttgttgaattatgcgagtgggaaagttgtgctggctttagaagggggctac
gatttgaaaagcatttctgaagccgctcaacagtgtgttcaggcactcattggcgaatcc
gatgacgcaggtcggttgagctcagttgctctcgaatcattacctaatccaagtgcagtt
gagacgttacaaaaggtcattgctattcacaaaagttattggcctgctttacatggtcaa
gaggccgcaattaacacaacggaaatgcaatggaggaatttgaagctccaagtacaaatg
cagcagcaacaacaacaacaacaaacgtag

DBGET integrated database retrieval system