KEGG   Cedecea neteri: LH23_04080Help
Entry
LH23_04080        CDS       T03328                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cem  Cedecea neteri
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cem00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LH23_04080
   00650 Butanoate metabolism
    LH23_04080
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH23_04080
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH23_04080
Enzymes [BR:cem01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LH23_04080
Amino acid related enzymes [BR:cem01007]
 Aminotransferase (transaminase)
  Class III
   LH23_04080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(847514..848779)
Genome map
AA seq 421 aa AA seqDB search
MKSAELNQRRLQATPRGVGVMCSYFAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAVEKQLQAFTHTAYQIVPYESYVSLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTKRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVTTD
DALKSLDRIFKADIAADQVAAIVLEPVQGEGGFNVAPPEFMQALRQLCDTHCILLIADEV
QTGFARTGKLFAMDYYDVKADLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIKEEQLCKRATQLGEHLKEVLNQARQSCPAIVDVRGQGSMVAVEFND
PQTGKPSPEYTREVQLKAQEKGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALAILSQVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgcagagctgaatcagcgtcgtttacaggccacgccgcgcggtgtaggcgtg
atgtgtagctactttgcagagaaggcggagaacgccaccctgtgggatgtggaaggcaac
gaggttatcgacttcgctgctgggatcgccgtgctgaacaccggccatcgtcacccgaaa
gtgattgccgctgtagaaaaacaattgcaggcctttacccacacggcttaccagattgtc
ccttatgaaagctacgtttcgctggccgagcgcattaacgaactggcgccgattgacggc
ccggcgaaaaccgcgttcttcactaccggtgcagaagcggttgagaatgcggtgaaaatc
gcccgcgcttataccaaacgtcccgggctgatcacctttggcggcggcttccatggccgt
acctttatgaccatggcgctgaccggcaaagtggcaccttacaaaatcggttttggccca
ttccctggctctgtctaccacgcggtttacccgaatgccgctcacggcgtgacaacagac
gatgcgctgaaaagcctggatcgcatctttaaagccgatatcgccgcggaccaggttgcg
gccatcgtactggagccggttcagggagaaggcggcttcaacgtggcgccacctgaattt
atgcaggcgctgcgtcagctgtgtgacacccactgcattctgctgattgccgatgaagtg
cagaccggcttcgcgcgcaccggcaagctgtttgcgatggactattacgacgtcaaagcc
gacctgatgacgatggcgaaaagcctggccggtggcttcccgttgtccggcgttgtcggc
cgtgccgaagtaatggatgcccctgcgcctggcggcctgggcggcacttatgcgggcaac
ccgctggcggttgcggcggctcacgcagtgctggatgtgatcaaagaagagcagctgtgc
aagcgtgcgacccagcttggtgaacacctgaaagaagtgctgaatcaggcgcgccaaagc
tgcccggcgattgtggacgtgcgcgggcagggttcaatggtggcggtggagtttaacgat
ccgcagaccgggaaaccttcgccagaatatacccgtgaagttcagctgaaagctcaggag
aaagggctgctgctgctgagctgcggtgtctacggcaacgttatccgcttcctttatccg
ctgaccattcctgatgctcagttcaccaaagctctggctattctgtcccaggtgcttaag
ggctaa

DBGET integrated database retrieval system