KEGG   Crinalium epipsammum: Cri9333_4171Help
Entry
Cri9333_4171      CDS       T02373                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cep  Crinalium epipsammum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cri9333_4171
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cri9333_4171
Enzymes [BR:cep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cri9333_4171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4708405..4708740)
Genome map
AA seq 111 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQIAKQIQYMIDQGFIPGVEFSESSAPEQHYWTLWKLPL
FNAGSVNEVLNEVKACRSEYSSNFIRVVGFDNVKQCQVLSFIVHKPTASRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactctacccaaagagcgtcgttacgaaactctctcctacttgccccccctcagc
gacgcacaaatcgccaagcaaatccaatacatgattgaccaaggatttattcctggcgtg
gagtttagcgaaagttctgctcctgagcaacactactggacactttggaagttgccttta
ttcaacgctggcagtgttaacgaagtgctaaatgaagtcaaagcttgtcgctctgaatat
tccagcaacttcatccgcgttgtaggttttgataacgtgaagcagtgccaagttcttagc
ttcatcgttcacaaaccaactgctagccgttactaa

DBGET integrated database retrieval system