KEGG   Crinalium epipsammum: Cri9333_4171Help
Entry
Cri9333_4171      CDS       T02373                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cep  Crinalium epipsammum
Pathway
cep00630  Glyoxylate and dicarboxylate metabolism
cep00710  Carbon fixation in photosynthetic organisms
cep01100  Metabolic pathways
cep01120  Microbial metabolism in diverse environments
cep01200  Carbon metabolism
Module
cep_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cep_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cep_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cri9333_4171
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cri9333_4171
Enzymes [BR:cep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cri9333_4171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ14963
UniProt: K9W3M8
LinkDB All DBs
Position
complement(4708405..4708740)
Genome map
AA seq 111 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQIAKQIQYMIDQGFIPGVEFSESSAPEQHYWTLWKLPL
FNAGSVNEVLNEVKACRSEYSSNFIRVVGFDNVKQCQVLSFIVHKPTASRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactctacccaaagagcgtcgttacgaaactctctcctacttgccccccctcagc
gacgcacaaatcgccaagcaaatccaatacatgattgaccaaggatttattcctggcgtg
gagtttagcgaaagttctgctcctgagcaacactactggacactttggaagttgccttta
ttcaacgctggcagtgttaacgaagtgctaaatgaagtcaaagcttgtcgctctgaatat
tccagcaacttcatccgcgttgtaggttttgataacgtgaagcagtgccaagttcttagc
ttcatcgttcacaaaccaactgctagccgttactaa

DBGET integrated database retrieval system