KEGG   Cellulosimicrobium sp. TH-20: B8281_11105Help
Entry
B8281_11105       CDS       T04804                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cet  Cellulosimicrobium sp. TH-20
Pathway
cet00620  Pyruvate metabolism
cet00680  Methane metabolism
cet01100  Metabolic pathways
cet01120  Microbial metabolism in diverse environments
cet01200  Carbon metabolism
Module
cet_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cet00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B8281_11105
  Energy metabolism
   00680 Methane metabolism
    B8281_11105
Enzymes [BR:cet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B8281_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARK06818
UniProt: A0A1W6DV83
LinkDB All DBs
Position
2524294..2527023
Genome map
AA seq 909 aa AA seqDB search
MSPSPGAADGPDRVSADVSDLPDDTGHAGRGLARHDVPGPLRDDVRLLGGLLGTVLRETG
GQDLLDDVERLRELSIRAYDDRSGAVLAEAEALVEGLSMARAEQVARAFTCYFHLANLAE
EYHRVRVLREREAEFATRATTPDDSLPEAFEQLVGEVGREEALRRLRRLEFRPVLTAHPT
EARRRAVSGAVRRIATLLDERDAQRLGGTSLAENERRLLAEIDTMWRTAPIREHKPSVLD
EVKTALGVFDATMFDTFPTVYRRLDDWLLGDEAGREEPLVRPFVSLGTWIGGDRDGNPNV
TADVTRQAAAIAADHALAALEQQARAVGRKLTLDQDGTPPSDGLRALWERQRRLSEAVTV
AASEASPREPHRAVLLVVADRIAATRARNADLAYPNAEQLESDLRVVQESLVAAGAPRAA
YGDLQQLVWQVETFGFHLAELEVRQHSQVHEGALAEIAEKGLHGDLSDRTREVLDTFRAL
GAVQQRYGIRAARRYIVSFTQKPEHLAAVYELAELAFEGSDEAPVVDAIPLFETFADLRA
SVDILESMLTLPQVQRRLAENGRRVEVMLGYSDSSKDVGPVSATLALHDAQSRIAQWAER
HDITLTLFHGRGGALGRGGGPANRAVLAQPPGSVDGRFKLTEQGEVILARYGDPTIASRH
IEQVAAATLLASAPSTEKRNAEATERYRDLAAALDESSRRRFHELVRADGFPQWFSQVTP
LEEVGLLPIGSRPARRGLSVSSLDDLRAIPWVFSWSQARINLAGWYGLGTALREFGDLEL
LREAHREWPLFATLLDNVEMSLAKTDERIAERYLALGDRDDLAQAILDELRLTREQVLAV
TENAWPLAGRRVLGRAVQLRSPYVDALSLLQVRALRGLRSGAEGPVKDELQHLLLLTVNG
VAAGLQNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
ctgtccccgtccccgggtgctgccgacggccccgaccgggtctccgccgacgtctccgac
ctccccgacgacaccgggcacgccgggcgcggcctcgcgcgccacgacgtcccgggcccg
ctgcgcgacgacgtccgcctcctcggcggcctgctgggcaccgtgctgcgcgagacgggc
ggccaggacctgctcgacgacgtcgagcggctccgcgagctctcgatccgtgcgtacgac
gaccggtcgggcgcggtgctcgccgaggccgaggcgctcgtcgagggcctgtccatggcg
cgcgccgagcaggtcgcccgggccttcacgtgctacttccacctcgcgaacctcgcggag
gagtaccaccgcgtgcgcgtcctgcgcgagcgcgaggcggagttcgcgacccgcgccacg
acgcccgacgactcgctgcccgaggcgttcgagcagctcgtcggcgaggtcgggcgcgag
gaggcgctgcgccggcttcgtcgcctcgagttccgccccgtgctcaccgcgcaccccacg
gaggcgcgccgtcgtgcggtctccggcgcggtgcggcgcatcgcgacgctcctcgacgag
cgggacgcgcagcgcctcggcggcacgtcgctcgcggagaacgagcgtcgcctcctcgcc
gagatcgacacgatgtggcgcaccgcccccatccgcgagcacaagccgtcggtcctcgac
gaggtgaagacggcgctcggcgtgttcgacgcgacgatgttcgacacgttccccaccgtc
taccgccgcctggacgactggctgctgggcgacgaggcggggcgcgaggagccgctcgtg
cggccgttcgtcagcctgggcacgtggatcggcggcgaccgcgacggcaacccgaacgtc
acggccgacgtgacgcgccaggccgcggcaatcgcggccgaccacgcgctcgcggcgctc
gagcagcaggcgcgcgccgtcgggcgcaagctcacgctcgaccaggacggcacgccgccg
tcggacggcctgcgcgccctgtgggagcgccagcgccggctctcggaggcggtcaccgtc
gccgcgtcggaggcgtcgccgcgcgagccgcaccgcgcggtcctgctcgtcgtcgcggac
cgcatcgccgcgacgcgggcccgcaacgccgacctcgcctacccgaacgccgagcagctc
gagtccgacctgcgcgtcgtccaggagtcgctcgttgcggcgggcgcgccccgcgcggcg
tacggggacctgcagcagctcgtgtggcaggtcgagacgttcgggttccacctcgcggag
ctcgaggtgcgccagcactcccaggtccacgagggggcgctcgccgagatcgcggagaag
ggcctgcacggcgacctctccgaccgtacgcgcgaggtgctcgacaccttccgcgcgctc
ggcgcggtccagcagcgctacgggatccgtgccgcacgccgctacatcgtgtcgttcacg
cagaagccggagcacctggccgcggtgtacgagctcgcggagctcgcgttcgagggctcc
gacgaggcgcccgtggtcgacgcgatcccgctgttcgagaccttcgccgacctccgggcg
agcgtcgacatcctcgagtccatgctcacgctgccgcaggtgcagcgccggctcgccgag
aacgggcgccgcgtcgaggtcatgctcggctactcggactcgtcgaaggacgtcggcccg
gtgtccgcgaccctcgccctgcacgacgcgcagagccgcatcgcgcagtgggccgagcgc
cacgacatcacgctcacgctgttccacggccgcggcggcgccctcggccgcggcggcggc
ccggcgaaccgtgccgtgctcgcccagcccccgggctcggtcgacggccgcttcaagctc
accgagcagggcgaggtcatcctcgcgcgttacggcgacccgacgatcgcgtcgcgccac
atcgagcaggtcgccgcggcgacgctgctcgcgtcggcgccgtcgacggagaagcgcaac
gccgaggcgaccgagcgctaccgcgacctcgcggccgcgctcgacgagtcgtcgcgccgc
cggttccacgagctggtgcgcgcggacgggttcccgcagtggttctcgcaggtgaccccg
ctcgaggaggtcggcctcctgccgatcggctcccgcccggcacgtcgcggcctgtcggtc
tcgtcgctcgacgacctgcgcgcgatcccgtgggtgttctcctggtcgcaggcgcgcatc
aacctcgcgggctggtacgggctcggcacggcgctgcgcgagttcggcgacctcgagctg
ctgcgcgaggcgcaccgcgagtggccgctcttcgcgacgctgctggacaacgtcgagatg
tcgctcgccaagacggacgagcgcatcgccgagcggtacctggcgctcggggaccgcgac
gacctcgcccaggcgatcctcgacgagctgcgcctcacgcgcgagcaggtcctcgcggtg
acggagaacgcgtggccgctcgccggccggcgcgtgctgggccgcgcggtccaactccgc
agcccgtacgtcgacgcgctctcgctgctccaggtccgcgcgctgcgcggcctgcgctcc
ggcgcggagggccctgtcaaggacgagctccagcacctgctgctgctcaccgtcaacggg
gtcgcggccggcctgcagaacaccggctga

DBGET integrated database retrieval system