KEGG   Cellulosimicrobium sp. TH-20: B8281_17465Help
Entry
B8281_17465       CDS       T04804                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cet  Cellulosimicrobium sp. TH-20
Pathway
cet00473  D-Alanine metabolism
cet01100  Metabolic pathways
cet01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cet00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B8281_17465
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B8281_17465
Enzymes [BR:cet01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B8281_17465
Peptidoglycan biosynthesis and degradation proteins [BR:cet01011]
 Precursor biosynthesis
  Racemase
   B8281_17465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARK06250
UniProt: A0A1W6DTG4
LinkDB All DBs
Position
complement(3918174..3919598)
Genome map
AA seq 474 aa AA seqDB search
MSDTQRTTSPGTHPGTPAGAPGTVPTGARAGSLAGPAPTSRASGSDGPDPRAYPARAVVD
LAAVRDNVRALADLAPSSQVMAVVKADAYGHGLVASALGALAGGATWLGTAQPGEALALR
AAGVGPDRARVLTWLYPPGAPLRDLVEADVDVSLAARWAVDEVVAAARAAGRTARVHLAV
DTGLGRNGIMPADLPDVLDAVARAEAEGAVRVVGMWSHLAFADEPGHPTVVSQADVFDEA
VREAARAGVVPELRHLANSAATLTAPRTHYDLVRPGLAAYGMTPVPQLGPPSRFGLRPAM
TLEARLATVKRVPGGHGVSYSHHYTTPQDTTLGVVPLGYGDGIPRHASGGGPAGAPGGPV
LVGARPGEPGGRVVRVAGRVCMDQLVLDLGPDATERAGDVVTLFGAGDGVARAGFPTAED
WAQAAGTISYEITTRLGARVPREHVGTHVLDDGARALLARDPSPHDSTERTVRA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacacccagcgcacgacctctcccggcacacatcccggcacacccgccggcgcc
cccggcaccgtcccgaccggcgcccgggcgggctccctcgcgggccccgccccgacgtcc
cgcgcgagcggctccgacggcccggacccccgcgcctacccggcccgcgccgtcgtcgac
ctggcggcggtgcgcgacaacgtgcgcgcgctcgcggacctcgcgccgtcgtcccaggtg
atggccgtggtcaaggcggacgcgtacgggcacgggctcgtcgcgagcgcgctcggggcg
ctcgcgggcggtgcgacgtggctcgggacggcgcagccgggcgaggcgctcgcgctgcgg
gcggcgggagtcggcccggaccgcgcgcgcgtgctcacgtggctctacccgccgggcgcg
ccgctgcgcgacctcgtggaggcggacgtcgacgtgtcgctcgcggcgcgctgggccgtg
gacgaggtcgtcgccgcggcgcgggccgcgggccggaccgcccgggtgcacctcgcggtc
gacacgggcctgggccgcaacgggatcatgcccgcggacctgcccgacgtgctcgacgcc
gtggcgcgcgccgaggcggagggtgccgtgcgcgtcgtcggcatgtggtcgcacctggcg
ttcgcggacgagcccggccacccgaccgtcgtctcgcaggccgacgtcttcgacgaggcc
gtgcgcgaggccgcgcgggcgggcgtcgtgccggagttgcgccacctcgcgaactccgcc
gcgacgctcacggccccccgcacccactacgacctcgtgcgcccgggcttggccgcgtac
gggatgacgcccgtgccgcagctcgggccgccgtcgcggttcggactgcgccccgcgatg
acgctcgaggcgcgcctcgcgacggtcaagcgcgtgcccggcggtcacggcgtctcctac
tcgcaccactacacgacgccgcaggacacgacgctcggcgtcgtgccgctcggctacggc
gacgggatcccgcgccacgcgtcgggcggcgggcccgcgggcgcgccgggcgggccggta
ctcgtcggcgcccgcccgggagagcccggcgggcgcgtcgtgcgcgtcgcgggccgggtc
tgcatggaccagctcgtgctcgacctcggcccggacgcgaccgagcgcgcgggcgacgtc
gtcacgctgttcggcgcgggcgacggcgtggcgcgcgccgggttccccacggccgaggac
tgggcgcaggccgcgggcaccatcagctacgagatcacgacgcgcctcggtgcgcgcgtg
ccgcgcgagcacgtggggacgcacgtgctcgacgacggcgcgcgggcgctcctggcgcgc
gacccgagcccgcacgacagcacggaaaggacggtccgcgcgtga

DBGET integrated database retrieval system